StarFunc result for job id Q9H4H8

User Input

>input (585 residues)
MALLSEGLDEVPAACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRERLARFL
NPDEVHAILRAAERPGEEGAAAAAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAF
YQGAYRGATRVETHFQPRGAGEGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQ
EICRKQGVAVYILLDQALLSQFLDMCMDLKVHPEQEKLMTVRTITGNIYYARSGTKIIGK
VHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVVEHFDLEFRILYAQSKPISPK
LLSHFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAEGKAERKP
HDCESSTVSEEDYFSSHRDELQSRKAIDAATQTEPGEEMPGLSVSEVGTQTSITTACAGT
QTAVITRIASSQTTIWSRSTTTQTDMDENILFPRGTQSTEGSPVSKMSVSRSSSLKSSSS
VSSQGSVASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRS
RLNHMLAMLSRRTLFTENHLGLHSGNFSRVNLLAVRDVALYPSYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WXK8	0.558	0.533	2.489E-90	615	1.000	0.951	A0A087WXK8.pdb.gz	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
2	AFDB:Q9BQN1	0.413	0.327	2.323E-28	747	0.253	0.198	Q9BQN1.pdb.gz	FA83C_HUMAN Protein FAM83C OS=Homo sapiens OX=9606 GN=FAM83C PE=1 SV=3
3	AFDB:Q86UY5	0.404	0.537	5.624E-27	434	0.198	0.267	Q86UY5.pdb.gz	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
4	PDB:6kz8A	0.208	0.160	2.829E-6	784	0.067	0.050	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
5	PDB:7v55A	0.208	0.160	2.511E-5	781	0.051	0.038	7v55A.pdb.gz	Structural insights into PA3488-mediated inactivation of Pseudomonas aeruginosa PldA.
6	PDB:7wdkA	0.206	0.144	6.085E-5	867	0.087	0.059	7wdkA.pdb.gz
7	PDB:1xdpA	0.198	0.171	1.035E-4	687	0.046	0.039	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
8	PDB:7v53A	0.183	0.120	5.402E-4	930	0.044	0.028	7v53A.pdb.gz
9	PDB:1q32B	0.117	0.157	2.991E-3	420	0.027	0.038	1q32B.pdb.gz
10	PDB:1httA	0.087	0.121	7.680E-2	366	0.032	0.052	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
11	PDB:1kmmC	0.092	0.126	1.161E-1	387	0.034	0.052	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
12	PDB:4eu1A	0.095	0.135	1.231E-1	383	0.036	0.055	4eu1A.pdb.gz
13	AFDB:Q9VBH3	0.070	0.053	1.582E-1	920	0.072	0.046	Q9VBH3.pdb.gz	Q9VBH3_DROME Dysfusion, isoform D OS=Drosophila melanogaster OX=7227 GN=dysf PE=4 SV=4
14	PDB:5xvrA	0.095	0.141	1.861E-1	381	0.029	0.045	5xvrA.pdb.gz	Structural basis of protein arginine rhamnosylation by glycosyltransferase EarP
15	AFDB:F8W2W5	0.053	0.041	3.212E-1	810	0.089	0.064	F8W2W5.pdb.gz	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
16	AFDB:Q6UXX5	0.062	0.038	3.615E-1	1313	0.109	0.049	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
17	AFDB:Q9Y330	0.060	0.073	4.577E-1	459	0.055	0.070	Q9Y330.pdb.gz	ZBT12_HUMAN Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZBTB12 PE=1 SV=1
18	AFDB:E1C5G3	0.053	0.044	5.796E-1	766	0.101	0.077	E1C5G3.pdb.gz	E1C5G3_CHICK SIM bHLH transcription factor 1 OS=Gallus gallus OX=9031 GN=SIM1 PE=4 SV=1
19	AFDB:Q6ZN04	0.065	0.067	6.918E-1	569	0.121	0.125	Q6ZN04.pdb.gz	MEX3B_HUMAN RNA-binding protein MEX3B OS=Homo sapiens OX=9606 GN=MEX3B PE=1 SV=1
20	AFDB:Q69Z36	0.056	0.055	8.258E-1	601	0.080	0.078	Q69Z36.pdb.gz	MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus OX=10090 GN=Mex3b PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WXK8	0.0	1209	615	1.000	0.951	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
2	Q9H4H8	0.0	1209	585	1.000	1.000	FA83D_HUMAN Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=3
3	Q2M2I3	2.99e-53	190	478	0.200	0.245	FA83E_HUMAN Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2
4	A6ND36	5.62e-52	193	823	0.198	0.141	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
5	Q8NEG4	2.30e-51	186	500	0.197	0.230	FA83F_HUMAN Protein FAM83F OS=Homo sapiens OX=9606 GN=FAM83F PE=1 SV=1
6	Q5T0W9	3.25e-51	192	1011	0.176	0.102	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
7	Q6ZRV2	1.27e-46	178	1179	0.186	0.092	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
8	Q9BQN1	9.82e-46	174	747	0.154	0.120	FA83C_HUMAN Protein FAM83C OS=Homo sapiens OX=9606 GN=FAM83C PE=1 SV=3
9	Q86UY5	1.48e-42	160	434	0.171	0.230	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
10	Q5SWZ9	0.74	34.7	221	0.043	0.113	PLD6_MOUSE Mitochondrial cardiolipin hydrolase OS=Mus musculus OX=10090 GN=Pld6 PE=1 SV=1
11	M9PC41	0.96	35.0	22743	0.079	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	P08117	2.0	33.5	413	0.039	0.056	AMY3_WHEAT Alpha-amylase AMY3 OS=Triticum aestivum OX=4565 GN=AMY1.1 PE=2 SV=1
13	Q8N2A8	4.0	32.3	252	0.043	0.099	PLD6_HUMAN Mitochondrial cardiolipin hydrolase OS=Homo sapiens OX=9606 GN=PLD6 PE=1 SV=1
14	P24183	5.1	32.7	1015	0.027	0.016	FDNG_ECOLI Formate dehydrogenase, nitrate-inducible, major subunit OS=Escherichia coli (strain K12) OX=83333 GN=fdnG PE=1 SV=3
15	Q92328	7.4	31.6	271	0.041	0.089	MDM12_YEAST Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07894 FAM83	2.9e-97	337.1	FAM83 A-H
2	PF13091 PLDc_2	3.1e-06	38.6	PLD-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481110

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377492	0.947	Hyaluronan mediated motility receptor
2	9606.ENSP00000421689	0.894	Casein kinase I isoform alpha
3	9606.ENSP00000363524	0.876	Chromosome-associated kinesin KIF4A
4	9606.ENSP00000300403	0.849	Targeting protein for Xklp2
5	9606.ENSP00000302530	0.824	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000378356	0.816	Kinesin-like protein KIF20A
7	9606.ENSP00000361540	0.813	Cell division cycle protein 20 homolog
8	9606.ENSP00000287598	0.803	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
9	9606.ENSP00000376297	0.801	Dynein light chain 1, cytoplasmic
10	9606.ENSP00000216911	0.790	Aurora kinase A
11	9606.ENSP00000275517	0.785	Sororin
12	9606.ENSP00000274026	0.779	Cyclin-A2
13	9606.ENSP00000306473	0.774	SHC SH2 domain-binding protein 1
14	9606.ENSP00000411532	0.772	DNA topoisomerase 2-alpha
15	9606.ENSP00000428489	0.772	Lymphokine-activated killer T-cell-originated protein kinase
16	9606.ENSP00000260363	0.768	Kinesin-like protein KIF23
17	9606.ENSP00000265748	0.756	Anillin
18	9606.ENSP00000336868	0.756	Histone H3-like centromeric protein A
19	9606.ENSP00000362146	0.754	Borealin
20	9606.ENSP00000356379	0.748	Abnormal spindle-like microcephaly-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0008017	0.999	microtubule binding
GO:0019894	0.993	kinesin binding
GO:0003824	0.325	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051641	0.990	cellular localization
GO:0007049	0.985	cell cycle
GO:0022402	0.973	cell cycle process
GO:0008283	0.939	cell population proliferation
GO:0051726	0.900	regulation of cell cycle
GO:0007059	0.897	chromosome segregation
GO:0023051	0.880	regulation of signaling
GO:0010564	0.874	regulation of cell cycle process
GO:0048518	0.870	positive regulation of biological process
GO:0048522	0.843	positive regulation of cellular process
GO:0019222	0.829	regulation of metabolic process
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0051171	0.807	regulation of nitrogen compound metabolic process
GO:0010646	0.806	regulation of cell communication
GO:0080090	0.802	regulation of primary metabolic process
GO:0098813	0.766	nuclear chromosome segregation
GO:0051640	0.703	organelle localization
GO:0032502	0.656	developmental process
GO:0048856	0.648	anatomical structure development
GO:1901987	0.643	regulation of cell cycle phase transition
GO:0009966	0.581	regulation of signal transduction
GO:0008104	0.565	protein localization
GO:1902531	0.560	regulation of intracellular signal transduction
GO:0044380	0.543	protein localization to cytoskeleton
GO:0045787	0.539	positive regulation of cell cycle
GO:0051649	0.513	establishment of localization in cell
GO:0090068	0.507	positive regulation of cell cycle process
GO:0051656	0.505	establishment of organelle localization
GO:0051303	0.501	establishment of chromosome localization
GO:0009888	0.487	tissue development
GO:0051310	0.484	metaphase plate congression
GO:0071840	0.447	cellular component organization or biogenesis
GO:0051246	0.445	regulation of protein metabolic process
GO:0050896	0.438	response to stimulus
GO:0000278	0.433	mitotic cell cycle
GO:0016043	0.427	cellular component organization
GO:0043408	0.405	regulation of MAPK cascade
GO:0070372	0.394	regulation of ERK1 and ERK2 cascade
GO:0051716	0.386	cellular response to stimulus
GO:0006996	0.386	organelle organization
GO:0048869	0.368	cellular developmental process
GO:1901989	0.368	positive regulation of cell cycle phase transition
GO:0030154	0.361	cell differentiation
GO:0032006	0.345	regulation of TOR signaling
GO:1902806	0.337	regulation of cell cycle G1/S phase transition
GO:0048513	0.334	animal organ development
GO:0042176	0.333	regulation of protein catabolic process
GO:0016477	0.327	cell migration
GO:1903047	0.321	mitotic cell cycle process
GO:0048762	0.320	mesenchymal cell differentiation
GO:0072698	0.308	protein localization to microtubule cytoskeleton
GO:1902808	0.308	positive regulation of cell cycle G1/S phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045171	0.999	intercellular bridge
GO:0005829	0.999	cytosol
GO:0072686	0.999	mitotic spindle
GO:0043231	0.758	intracellular membrane-bounded organelle
GO:0005634	0.746	nucleus
GO:0070013	0.542	intracellular organelle lumen
GO:0031981	0.528	nuclear lumen
GO:0005654	0.479	nucleoplasm
GO:0000922	0.471	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]