StarFunc result for job id Q9H4K7

User Input

>input (406 residues)
MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGK
KLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQ
QVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEY
IAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSL
LRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHI
ERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLR
DHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4K7	1.000	1.000	2.739E-86	406	1.000	1.000	Q9H4K7.pdb.gz	MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens OX=9606 GN=MTG2 PE=1 SV=1
2	AFDB:A2AFK4	0.682	0.684	2.473E-69	405	0.805	0.807	A2AFK4.pdb.gz	A2AFK4_MOUSE Mitochondrial ribosome associated GTPase 2 OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
3	PDB:7o9kG	0.638	0.749	5.252E-56	337	0.825	0.994	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
4	PDB:7odtt	0.673	0.844	2.845E-54	316	0.776	0.997	7odtt.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
5	AFDB:Q0D3S3	0.568	0.338	7.476E-41	752	0.330	0.178	Q0D3S3.pdb.gz	OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=OBGC1 PE=3 SV=1
6	AFDB:Q8L7L0	0.614	0.395	8.916E-41	681	0.328	0.195	Q8L7L0.pdb.gz	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
7	AFDB:P9WMT1	0.632	0.547	2.720E-40	479	0.365	0.309	P9WMT1.pdb.gz	OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=obg PE=1 SV=1
8	AFDB:Q38AM0	0.431	0.374	7.285E-39	472	0.330	0.284	Q38AM0.pdb.gz	Q38AM0_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3230 PE=3 SV=1
9	AFDB:Q5F5D9	0.611	0.641	1.390E-38	384	0.333	0.352	Q5F5D9.pdb.gz	OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=obg PE=1 SV=1
10	AFDB:Q5L6R9	0.628	0.744	5.953E-37	335	0.325	0.394	Q5L6R9.pdb.gz	OBG_CHLAB GTPase Obg OS=Chlamydia abortus (strain DSM 27085 / S26/3) OX=218497 GN=obg PE=3 SV=1
11	AFDB:P42641	0.456	0.470	1.901E-35	390	0.318	0.331	P42641.pdb.gz	OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) OX=83333 GN=obgE PE=1 SV=1
12	AFDB:Q9UT06	0.425	0.414	1.158E-33	419	0.308	0.298	Q9UT06.pdb.gz	YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP8A3.11c PE=3 SV=1
13	PDB:7bl29P1	0.583	0.679	3.107E-29	338	0.315	0.379	7bl29P1.pdb.gz	Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
14	PDB:7oi6y	0.414	0.485	7.078E-20	331	0.286	0.350	7oi6y.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.
15	PDB:6n8jb	0.297	0.200	8.130E-8	647	0.113	0.071	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
16	PDB:5ady6	0.313	0.299	3.967E-7	426	0.116	0.110	5ady6.pdb.gz	Hflx is a Ribosome Splitting Factor Rescuing Stalled Ribosomes Under Stress Conditions
17	PDB:1wf3A	0.314	0.416	8.511E-7	296	0.106	0.145	1wf3A.pdb.gz	Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
18	PDB:4zi2A	0.295	0.597	1.210E-6	185	0.106	0.232	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
19	PDB:2k5uA	0.269	0.518	1.361E-6	180	0.091	0.206	2k5uA.pdb.gz	Structure and Membrane Interaction of Myristoylated ARF1
20	PDB:6lss4	0.267	0.187	1.722E-6	620	0.123	0.081	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AFK4	0.0	590	405	0.805	0.807	A2AFK4_MOUSE Mitochondrial ribosome associated GTPase 2 OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
2	Q9H4K7	0.0	826	406	1.000	1.000	MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens OX=9606 GN=MTG2 PE=1 SV=1
3	I6L986	2.59e-97	291	231	0.448	0.788	I6L986_MOUSE Gtpbp5 protein OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
4	Q5L6R9	3.93e-58	195	335	0.333	0.403	OBG_CHLAB GTPase Obg OS=Chlamydia abortus (strain DSM 27085 / S26/3) OX=218497 GN=obg PE=3 SV=1
5	P9WMT1	1.06e-57	197	479	0.374	0.317	OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=obg PE=1 SV=1
6	A4D1E9	3.82e-56	191	387	0.333	0.349	GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1
7	P42641	2.31e-55	189	390	0.325	0.338	OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) OX=83333 GN=obgE PE=1 SV=1
8	Q8R2K9	6.25e-55	181	189	0.291	0.624	Q8R2K9_MOUSE Gtpbp5 protein OS=Mus musculus OX=10090 GN=Mtg2 PE=2 SV=1
9	Q8K013	5.04e-52	180	366	0.305	0.339	GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus OX=10090 GN=Gtpbp10 PE=2 SV=1
10	Q5F5D9	7.75e-51	177	384	0.303	0.320	OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=obg PE=1 SV=1
11	Q38AM0	1.47e-47	171	472	0.303	0.261	Q38AM0_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3230 PE=3 SV=1
12	Q0D3S3	8.62e-47	172	752	0.300	0.162	OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=OBGC1 PE=3 SV=1
13	Q8L7L0	1.16e-43	163	681	0.296	0.176	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
14	Q9UT06	5.18e-40	149	419	0.305	0.296	YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP8A3.11c PE=3 SV=1
15	P38860	3.47e-31	126	518	0.185	0.145	MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTG2 PE=1 SV=2
16	P39729	5.73e-14	75.1	369	0.108	0.119	RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBG1 PE=1 SV=1
17	P32235	8.70e-14	74.3	364	0.108	0.121	GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtp1 PE=3 SV=2
18	P32233	3.32e-13	72.8	367	0.108	0.120	DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus OX=10090 GN=Drg1 PE=1 SV=1
19	Q9Y295	4.21e-13	72.4	367	0.108	0.120	DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1
20	Q38AS7	5.17e-13	72.0	368	0.103	0.114	Q38AS7_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3970 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.038	24.9	ADP-ribosylation factor family
2	PF00350 Dynamin_N	4	19.0	Dynamin family
3	PF02421 FeoB_N	4.1e-08	44.4	Ferrous iron transport protein B
4	PF01018 GTP1_OBG	2e-39	146.2	GTP1/OBG
5	PF01926 MMR_HSR1	1.7e-20	84.6	50S ribosome-binding GTPase
6	PF08438 MMR_HSR1_C	60	15.6	GTPase of unknown function C-terminal
7	PF03193 RsgA_GTPase	32	15.9	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263629	0.881	Translation initiation factor IF-2, mitochondrial
2	9606.ENSP00000323047	0.868	Mitochondrial ribosome-associated GTPase 1
3	9606.ENSP00000419370	0.860	Mitochondrial assembly of ribosomal large subunit protein 1
4	9606.ENSP00000242257	0.849	rRNA methyltransferase 2, mitochondrial
5	9606.ENSP00000281543	0.816	Translation factor GUF1, mitochondrial
6	9606.ENSP00000419740	0.815	5-methylcytosine rRNA methyltransferase NSUN4
7	9606.ENSP00000480378	0.809	Transcription termination factor 4, mitochondrial
8	9606.ENSP00000301585	0.804	Peptidyl-tRNA hydrolase ICT1, mitochondrial
9	9606.ENSP00000264230	0.800	Nitric oxide-associated protein 1
10	9606.ENSP00000254928	0.779	GTPase Era, mitochondrial
11	9606.ENSP00000481559	0.753	rRNA methyltransferase 1, mitochondrial
12	9606.ENSP00000287025	0.749	Transcription termination factor 3, mitochondrial
13	9606.ENSP00000245539	0.732	Mitochondrial ribosomal protein S7
14	9606.ENSP00000355086	0.730	Aspartate--tRNA ligase, mitochondrial
15	9606.ENSP00000225969	0.714	Mitochondrial ribosomal protein L27
16	9606.ENSP00000223324	0.710	Mitochondrial ribosomal protein L32
17	9606.ENSP00000354580	0.693	Mitochondrial ribosomal protein L21
18	9606.ENSP00000236980	0.690	FAST kinase domain-containing protein 2, mitochondrial
19	9606.ENSP00000254630	0.685	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
20	9606.ENSP00000332340	0.681	Probable ATP-dependent RNA helicase DDX28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003924	1.000	GTPase activity
GO:0005488	0.996	binding
GO:0005515	0.963	protein binding
GO:0097159	0.954	organic cyclic compound binding
GO:1901363	0.953	heterocyclic compound binding
GO:0003723	0.822	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.918	regulation of cellular metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0080090	0.912	regulation of primary metabolic process
GO:0060255	0.904	regulation of macromolecule metabolic process
GO:0006417	0.879	regulation of translation
GO:0009987	0.811	cellular process
GO:0070129	0.808	regulation of mitochondrial translation
GO:0071704	0.779	organic substance metabolic process
GO:0044238	0.709	primary metabolic process
GO:0006807	0.697	nitrogen compound metabolic process
GO:0044057	0.646	regulation of system process
GO:0044237	0.566	cellular metabolic process
GO:0043170	0.465	macromolecule metabolic process
GO:0071840	0.360	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.988	intracellular organelle lumen
GO:0016020	0.962	membrane
GO:0043228	0.947	non-membrane-bounded organelle
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005740	0.899	mitochondrial envelope
GO:0031090	0.895	organelle membrane
GO:0019866	0.871	organelle inner membrane
GO:0005759	0.852	mitochondrial matrix
GO:0005743	0.850	mitochondrial inner membrane
GO:0005840	0.839	ribosome
GO:0000313	0.507	organellar ribosome
GO:0005761	0.494	mitochondrial ribosome
GO:0032991	0.348	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]