StarFunc result for job id Q9H4L4

User Input

>input (574 residues)
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPA
RRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRK
TCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVP
SPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGL
LSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPG
EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLV
LQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPE
KVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITY
FDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYC
KHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4L4	1.000	1.000	2.625E-92	574	1.000	1.000	Q9H4L4.pdb.gz	SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2
2	AFDB:Q5B9U1	0.302	0.182	3.751E-15	965	0.225	0.134	Q5B9U1.pdb.gz	Q5B9U1_EMENI Nuclear pore complex subunit Nup133, putative (AFU_orthologue AFUA_5G14040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02689 PE=3 SV=1
3	AFDB:Q9VWK5	0.328	0.128	5.222E-15	1513	0.193	0.073	Q9VWK5.pdb.gz	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
4	PDB:2bkrA	0.286	0.722	3.223E-9	211	0.070	0.190	2bkrA.pdb.gz
5	PDB:5hafB	0.256	0.409	4.601E-7	327	0.068	0.119	5hafB.pdb.gz
6	PDB:5io3A	0.191	0.261	5.333E-4	385	0.054	0.081	5io3A.pdb.gz
7	AFDB:Q9GZR1	0.276	0.147	2.377E-3	1112	0.195	0.101	Q9GZR1.pdb.gz	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
8	PDB:1avpA	0.168	0.396	3.880E-3	204	0.040	0.113	1avpA.pdb.gz	Crystal structure of the human adenovirus proteinase with its 11 amino acid cofactor.
9	AFDB:Q5PQX1	0.057	0.057	1.258E-1	583	0.136	0.134	Q5PQX1.pdb.gz	TOIP1_RAT Torsin-1A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Tor1aip1 PE=1 SV=1
10	AFDB:A1ZAQ3	0.076	0.068	2.576E-1	682	0.096	0.081	A1ZAQ3.pdb.gz	A1ZAQ3_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG15612 PE=4 SV=2
11	AFDB:D4A7U1	0.057	0.058	2.576E-1	564	0.105	0.106	D4A7U1.pdb.gz	D4A7U1_RAT Zyxin OS=Rattus norvegicus OX=10116 GN=Zyx PE=1 SV=2
12	AFDB:Q5AMQ6	0.058	0.032	2.722E-1	1111	0.110	0.057	Q5AMQ6.pdb.gz	RFX2_CANAL RFX-like DNA-binding protein RFX2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RFX2 PE=2 SV=2
13	PDB:7zelA	0.079	0.061	3.978E-1	827	0.037	0.025	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
14	PDB:7mq8SM	0.078	0.123	5.240E-1	290	0.056	0.110	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:4ua3B	0.083	0.191	5.537E-1	194	0.031	0.093	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
16	PDB:7solA	0.056	0.041	5.537E-1	1011	0.059	0.034	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
17	PDB:1hlkA	0.074	0.145	6.903E-1	227	0.037	0.093	1hlkA.pdb.gz	Identification of a series of tricyclic natural products as potent broad spectrum inhibitors of metallo-beta-lactamases
18	PDB:4f1iA	0.072	0.106	7.708E-1	328	0.045	0.079	4f1iA.pdb.gz
19	AFDB:O13803	0.067	0.065	9.670E-1	601	0.122	0.116	O13803.pdb.gz	YE06_SCHPO Uncharacterized protein C17H9.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.06c PE=1 SV=1
20	AFDB:P46589	0.064	0.061	9.670E-1	612	0.068	0.064	P46589.pdb.gz	ADF1_CANAL Adherence factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADF1 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EP97	0.0	1066	568	0.946	0.956	SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus OX=10090 GN=Senp3 PE=1 SV=1
2	Q9H4L4	0.0	1184	574	1.000	1.000	SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2
3	J3QL36	7.46e-172	488	237	0.413	1.000	J3QL36_HUMAN SUMO specific peptidase 3 (Fragment) OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=1
4	Q96HI0	3.28e-97	314	755	0.258	0.196	SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens OX=9606 GN=SENP5 PE=1 SV=3
5	P59110	2.22e-47	177	640	0.148	0.133	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
6	Q9P0U3	4.72e-46	174	644	0.145	0.129	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
7	Q6IE23	1.11e-39	153	475	0.125	0.152	Q6IE23_RAT Sentrin/SUMO-specific protease 17 OS=Rattus norvegicus OX=10116 GN=Senp17 PE=2 SV=1
8	Q91ZX6	2.57e-38	151	588	0.124	0.121	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2
9	Q9EQE1	2.59e-38	150	588	0.132	0.129	SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus OX=10116 GN=Senp2 PE=1 SV=1
10	Q9HC62	2.91e-38	150	589	0.134	0.131	SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3
11	Q09353	1.59e-32	135	697	0.125	0.103	SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans OX=6239 GN=ulp-1 PE=2 SV=3
12	O42957	5.93e-29	123	568	0.124	0.125	ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp1 PE=3 SV=1
13	Q7KMN4	1.31e-28	123	674	0.106	0.091	Q7KMN4_DROME BcDNA.GH02751 OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=2 SV=1
14	Q5B9U1	1.33e-28	123	965	0.131	0.078	Q5B9U1_EMENI Nuclear pore complex subunit Nup133, putative (AFU_orthologue AFUA_5G14040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02689 PE=3 SV=1
15	Q9VWK5	2.98e-28	122	1513	0.111	0.042	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
16	A0A1D8PSK4	1.97e-24	108	491	0.108	0.126	A0A1D8PSK4_CANAL SUMO protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ULP2 PE=3 SV=1
17	Q8GYL3	3.73e-21	99.4	502	0.096	0.110	ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana OX=3702 GN=ULP1A PE=2 SV=2
18	Q94F30	4.70e-21	99.0	489	0.106	0.125	ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana OX=3702 GN=ESD4 PE=1 SV=1
19	Q02724	1.17e-15	82.4	621	0.101	0.093	ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP1 PE=1 SV=1
20	Q2PS26	4.11e-14	77.4	584	0.101	0.099	ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana OX=3702 GN=ULP1D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02902 Peptidase_C48	7.2e-43	158.5	Ulp1 protease family, C-terminal catalytic domain
2	PF19722 SENP3_5_N	7.1e-08	43.6	Sentrin-specific protease 3/5 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301396	0.999	Proline-, glutamic acid- and leucine-rich protein 1
2	9606.ENSP00000364037	0.996	Testis-expressed protein 10
3	9606.ENSP00000363944	0.993	Ribosomal biogenesis protein LAS1L
4	9606.ENSP00000476117	0.984	WD repeat-containing protein 18
5	9606.ENSP00000351446	0.977	WD repeat-containing protein 5
6	9606.ENSP00000376077	0.976	Small ubiquitin-related modifier 1
7	9606.ENSP00000264515	0.954	Retinoblastoma-binding protein 5
8	9606.ENSP00000366934	0.950	Polynucleotide 5'-hydroxyl-kinase NOL9
9	9606.ENSP00000405965	0.937	Small ubiquitin-related modifier 2
10	9606.ENSP00000436786	0.928	Histone-lysine N-methyltransferase 2A
11	9606.ENSP00000370201	0.923	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulatio [...]
12	9606.ENSP00000356480	0.918	E3 ubiquitin-protein ligase RING2
13	9606.ENSP00000346120	0.917	Nucleolar RNA helicase 2
14	9606.ENSP00000395772	0.912	Guanine nucleotide-binding protein-like 3
15	9606.ENSP00000407323	0.912	Probable rRNA-processing protein EBP2
16	9606.ENSP00000252996	0.911	Transcription initiation factor TFIID subunit 4
17	9606.ENSP00000309555	0.911	Host cell factor 1
18	9606.ENSP00000382863	0.911	Chromodomain-helicase-DNA-binding protein 8
19	9606.ENSP00000318297	0.909	RuvB-like 1
20	9606.ENSP00000399982	0.907	Transcription initiation factor TFIID subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019783	1.000	ubiquitin-like protein peptidase activity
GO:0008234	1.000	cysteine-type peptidase activity
GO:0016929	0.970	deSUMOylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0019538	0.987	protein metabolic process
GO:0018193	0.929	peptidyl-amino acid modification
GO:0070647	0.887	protein modification by small protein conjugation or removal
GO:0018205	0.797	peptidyl-lysine modification
GO:0006508	0.421	proteolysis
GO:0070646	0.316	protein modification by small protein removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0140513	0.978	nuclear protein-containing complex
GO:1990234	0.977	transferase complex
GO:0071339	0.948	MLL1 complex
GO:0005737	0.680	cytoplasm
GO:0005829	0.350	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]