StarFunc result for job id Q9H4L5

User Input

>input (887 residues)
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTE
EHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSIS
SRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLL
QSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVR
LHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREK
LKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNL
AEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISD
NLSLDNLSNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDL
SKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRA
GSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGK
SMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKV
NFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVWRANPMPKGYE
QYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERR
RVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4L5	1.000	1.000	0.000	887	1.000	1.000	Q9H4L5.pdb.gz	OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1
2	AFDB:Q9BZF3	0.573	0.549	9.140E-95	934	0.587	0.558	Q9BZF3.pdb.gz	OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6 PE=1 SV=1
3	AFDB:Q9BZF2	0.511	0.534	8.328E-82	842	0.488	0.514	Q9BZF2.pdb.gz	OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7 PE=1 SV=1
4	AFDB:Q969R2	0.395	0.383	2.545E-46	916	0.244	0.236	Q969R2.pdb.gz	OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2
5	AFDB:Q5QNQ6	0.396	0.387	4.573E-46	908	0.255	0.249	Q5QNQ6.pdb.gz	OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1
6	AFDB:P38713	0.399	0.358	5.006E-45	996	0.254	0.226	P38713.pdb.gz	OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH3 PE=1 SV=1
7	AFDB:O14340	0.398	0.273	4.444E-42	1310	0.250	0.169	O14340.pdb.gz	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
8	AFDB:Q9H1P3	0.408	0.742	2.880E-36	480	0.201	0.371	Q9H1P3.pdb.gz	OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens OX=9606 GN=OSBPL2 PE=1 SV=1
9	PDB:5zm8B	0.400	0.843	2.476E-34	413	0.185	0.397	5zm8B.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
10	PDB:5zm8A	0.377	0.848	2.230E-33	386	0.184	0.422	5zm8A.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
11	AFDB:Q54QP6	0.376	0.811	3.472E-28	402	0.134	0.296	Q54QP6.pdb.gz	OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum OX=44689 GN=osbH PE=1 SV=1
12	AFDB:Q93Y40	0.371	0.705	4.191E-27	457	0.139	0.269	Q93Y40.pdb.gz	ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana OX=3702 GN=ORP3C PE=2 SV=1
13	PDB:4ph7D	0.319	0.664	4.824E-18	407	0.099	0.216	4ph7D.pdb.gz	INTRACELLULAR TRANSPORT. Phosphatidylserine transport by ORP/Osh proteins is driven by phosphatidylinositol 4-phosphate.
14	PDB:4jchA	0.316	0.607	3.672E-14	436	0.094	0.190	4jchA.pdb.gz	Structure of OSH4 bound to an electrophilic oxysterol
15	PDB:3spwA	0.289	0.610	5.942E-13	398	0.086	0.191	3spwA.pdb.gz	Osh4p exchanges sterols for phosphatidylinositol 4-phosphate between lipid bilayers.
16	PDB:4iapA	0.085	0.287	2.974E-5	256	0.028	0.098	4iapA.pdb.gz
17	PDB:7c3mA	0.097	0.144	1.480E-3	577	0.028	0.043	7c3mA.pdb.gz
18	PDB:6u3eA	0.097	0.204	2.296E-3	397	0.027	0.060	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:3ljuX	0.080	0.186	2.932E-3	373	0.023	0.054	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:6bbpA	0.102	0.168	3.564E-3	520	0.029	0.050	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BZF2	0.0	797	842	0.490	0.517	OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7 PE=1 SV=1
2	Q9BZF3	0.0	1045	934	0.595	0.565	OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6 PE=1 SV=1
3	Q9H4L5	0.0	1842	887	1.000	1.000	OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1
4	Q9H1P3	3.27e-82	275	480	0.203	0.375	OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens OX=9606 GN=OSBPL2 PE=1 SV=1
5	P22059	9.91e-80	277	807	0.195	0.214	OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1
6	P16258	2.10e-79	276	809	0.195	0.214	OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=OSBP PE=1 SV=1
7	Q3B7Z2	2.25e-79	276	805	0.218	0.240	OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus OX=10090 GN=Osbp PE=1 SV=3
8	D4A9D8	2.34e-79	276	805	0.195	0.215	D4A9D8_RAT Oxysterol-binding protein OS=Rattus norvegicus OX=10116 GN=Osbp PE=1 SV=3
9	Q8K4M9	3.37e-78	275	950	0.182	0.169	OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus OX=10116 GN=Osbpl1a PE=1 SV=1
10	Q9BXW6	4.90e-78	275	950	0.196	0.183	OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2
11	Q91XL9	2.01e-77	273	950	0.182	0.169	OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus OX=10090 GN=Osbpl1a PE=1 SV=2
12	Q969R2	1.57e-75	267	916	0.180	0.175	OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2
13	O14340	1.81e-74	268	1310	0.162	0.110	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
14	Q9VC05	6.47e-74	260	784	0.149	0.168	Q9VC05_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=1 SV=1
15	Q5QNQ6	8.34e-74	262	908	0.176	0.172	OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1
16	O18397	1.34e-72	256	784	0.148	0.167	O18397_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=2 SV=2
17	Q12451	5.34e-72	261	1283	0.168	0.116	OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH2 PE=1 SV=1
18	P35845	7.56e-65	239	1188	0.157	0.117	OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWH1 PE=1 SV=4
19	O13944	2.63e-63	233	945	0.160	0.150	OSH3_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=osh3 PE=1 SV=2
20	P38713	8.11e-63	232	996	0.160	0.143	OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20531 DUF6746	3.7e+02	12.4	Family of unknown function (DUF6746)
2	PF01237 Oxysterol_BP	3.8e-130	445.7	Oxysterol-binding protein
3	PF00169 PH	0.00011	34.0	PH domain
4	PF15413 PH_11	6.7e+02	12.2	Pleckstrin homology domain
5	PF14593 PH_3	6.3e+02	11.8	PH domain
6	PF15409 PH_8	9.9e-09	46.7	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417175	0.864	Vesicle-associated membrane protein-associated protein B/C
2	9606.ENSP00000345656	0.815	Vesicle-associated membrane protein-associated protein A
3	9606.ENSP00000314499	0.724	Cyclin-G-associated kinase
4	9606.ENSP00000386647	0.693	Pejvakin
5	9606.ENSP00000376309	0.677	Heterogeneous nuclear ribonucleoprotein A3
6	9606.ENSP00000056233	0.676	Nuclear factor erythroid 2-related factor 3
7	9606.ENSP00000246792	0.664	Ras-related protein R-Ras
8	9606.ENSP00000346694	0.654	Heterogeneous nuclear ribonucleoproteins A2/B1
9	9606.ENSP00000380252	0.642	Nuclear factor erythroid 2-related factor 2
10	9606.ENSP00000286063	0.630	Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
11	9606.ENSP00000234313	0.598	Pleckstrin
12	9606.ENSP00000434442	0.563	ADP-ribosylation factor GTPase-activating protein 2
13	9606.ENSP00000349305	0.544	Golgin subfamily A member 4
14	9606.ENSP00000484415	0.530	Cytosolic 5'-nucleotidase 3A
15	9606.ENSP00000260116	0.526	Alpha-tocopherol transfer protein
16	9606.ENSP00000339587	0.520	Gasdermin-E
17	9606.ENSP00000361143	0.507	Transmembrane protein 164
18	9606.ENSP00000356607	0.502	Ras-specific guanine nucleotide-releasing factor RalGPS2
19	9606.ENSP00000355809	0.500	Protein enabled homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015248	1.000	sterol transporter activity
GO:0015485	0.999	cholesterol binding
GO:0043167	0.472	ion binding
GO:0043168	0.399	anion binding
GO:0120013	0.328	lipid transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0019752	0.975	carboxylic acid metabolic process
GO:1901362	0.973	organic cyclic compound biosynthetic process
GO:0008610	0.970	lipid biosynthetic process
GO:0046394	0.966	carboxylic acid biosynthetic process
GO:0008206	0.965	bile acid metabolic process
GO:0006694	0.964	steroid biosynthetic process
GO:1901617	0.963	organic hydroxy compound biosynthetic process
GO:0072330	0.962	monocarboxylic acid biosynthetic process
GO:0050789	0.548	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005783	1.000	endoplasmic reticulum
GO:0005634	0.999	nucleus
GO:0005886	0.998	plasma membrane
GO:0031090	0.997	organelle membrane
GO:0048471	0.969	perinuclear region of cytoplasm
GO:0097038	0.937	perinuclear endoplasmic reticulum
GO:0031975	0.827	envelope
GO:0031967	0.813	organelle envelope
GO:0005635	0.804	nuclear envelope
GO:0031965	0.724	nuclear membrane
GO:0031984	0.681	organelle subcompartment
GO:0098827	0.496	endoplasmic reticulum subcompartment
GO:0070013	0.479	intracellular organelle lumen
GO:0031981	0.469	nuclear lumen
GO:0042175	0.414	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.325	endoplasmic reticulum membrane
GO:0005654	0.303	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	1.000	cholesterol(in) = cholesterol(out)

[back to server]