StarFunc result for job id Q9H4L7

User Input

>input (1026 residues)
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDIT
EKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSEDVVSPNCSNTVQEKTFNKDTV
IIVSEPSEDEESQGLPTMARRNDDISELEDLSELEDLKDAKLQTLKELFPQRSDNDLLKL
IESTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEPYEEDEFNDDQSIKKTRLDHGEESN
ESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQY
VSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFNPKRVVEDSEY
DSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGELTLIPQCSQKKAQKITELRP
FNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLTGNG
GGWNIEQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLY
QEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVI
VTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPV
QNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFIL
RRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTEMCNVMMQLRK
MANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRHI
NNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRL
DGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAE
DRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATLL
KTSMGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4L7	1.000	1.000	0.000	1026	1.000	1.000	Q9H4L7.pdb.gz	SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2
2	AFDB:A0A1D8PGK4	0.430	0.267	4.854E-40	1690	0.245	0.149	A0A1D8PGK4.pdb.gz	A0A1D8PGK4_CANAL SWI/SNF catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF2 PE=4 SV=1
3	AFDB:Q9NRZ9	0.418	0.506	7.400E-39	838	0.222	0.272	Q9NRZ9.pdb.gz	HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS PE=1 SV=1
4	AFDB:Q3TKT4	0.426	0.277	7.762E-39	1613	0.257	0.164	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
5	AFDB:B7ZD98	0.410	0.490	1.590E-38	853	0.227	0.273	B7ZD98.pdb.gz
6	AFDB:Q585S8	0.420	0.373	2.821E-38	1160	0.205	0.181	Q585S8.pdb.gz	Q585S8_TRYB2 Transcription activator, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.35 PE=4 SV=1
7	AFDB:Q9XFH4	0.426	0.564	1.241E-37	764	0.211	0.283	Q9XFH4.pdb.gz	DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana OX=3702 GN=DDM1 PE=1 SV=1
8	AFDB:Q6EVK6	0.409	0.198	5.728E-37	2193	0.264	0.124	Q6EVK6.pdb.gz	BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana OX=3702 GN=BRM PE=1 SV=1
9	AFDB:P25439	0.439	0.282	6.302E-37	1638	0.252	0.158	P25439.pdb.gz	BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2
10	PDB:6jylK	0.407	0.808	1.615E-35	504	0.196	0.399	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
11	AFDB:Q54M42	0.416	0.219	3.842E-35	2005	0.191	0.098	Q54M42.pdb.gz	Q54M42_DICDI SNF2-related domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286219 PE=4 SV=1
12	PDB:6gejM	0.404	0.592	1.833E-33	688	0.205	0.305	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6tdaS	0.413	0.535	1.999E-32	783	0.194	0.254	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
14	PDB:7oo3b	0.389	0.718	2.496E-30	534	0.152	0.292	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
15	PDB:6uxwA	0.411	0.534	1.689E-29	778	0.202	0.266	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:6g0lM	0.389	0.464	1.142E-28	855	0.181	0.218	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:6g0lW	0.398	0.463	3.429E-28	878	0.180	0.211	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
18	PDB:6kw3Y	0.416	0.744	1.509E-27	548	0.190	0.356	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
19	PDB:7epuB	0.283	0.362	3.566E-27	748	0.174	0.239	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
20	PDB:5vvrM	0.359	0.687	8.215E-24	503	0.157	0.320	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q04692	0.0	1922	1021	0.924	0.929	SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus OX=10090 GN=Smarcad1 PE=1 SV=2
2	Q9H4L7	0.0	2130	1026	1.000	1.000	SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2
3	Q9VL72	0.0	571	844	0.288	0.351	SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster OX=7227 GN=Etl1 PE=1 SV=1
4	O74842	2.16e-171	538	1284	0.295	0.236	FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fft2 PE=1 SV=1
5	P87114	2.94e-167	517	944	0.292	0.318	FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fft1 PE=3 SV=1
6	O42861	3.81e-159	495	922	0.272	0.303	FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fft3 PE=1 SV=1
7	P31380	1.23e-139	450	1131	0.233	0.211	FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN30 PE=1 SV=1
8	Q9ZUL5	6.06e-121	390	763	0.233	0.313	CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana OX=3702 GN=ETL1 PE=1 SV=1
9	Q9NRZ9	2.96e-102	342	838	0.202	0.247	HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS PE=1 SV=1
10	Q60848	7.38e-102	340	821	0.204	0.255	HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus OX=10090 GN=Hells PE=1 SV=2
11	Q8RWY3	8.20e-101	343	1056	0.197	0.191	ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=4
12	F4JAV9	9.04e-101	343	1057	0.197	0.191	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1
13	F4JY25	2.67e-99	339	1072	0.194	0.186	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
14	F4JY24	2.90e-99	339	1069	0.194	0.186	CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
15	Q3BDS6	8.01e-99	333	853	0.199	0.239	Q3BDS6_DANRE Lymphoid-specific helicase OS=Danio rerio OX=7955 GN=cb65 PE=1 SV=1
16	Q60EX7	9.09e-99	338	1128	0.201	0.183	CHR19_ORYSJ Probable ATP-dependent DNA helicase CHR719 OS=Oryza sativa subsp. japonica OX=39947 GN=CHR719 PE=1 SV=1
17	Q08773	3.98e-98	337	1120	0.199	0.182	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
18	Q24368	4.53e-98	335	1027	0.190	0.190	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
19	F4K128	9.81e-98	335	1064	0.203	0.195	CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana OX=3702 GN=CHR23 PE=2 SV=1
20	A0A0A0MRP6	2.11e-97	333	1058	0.196	0.190	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	0.32	22.0	CUE domain
2	PF00270 DEAD	0.092	24.0	DEAD/DEAH box helicase
3	PF16203 ERCC3_RAD25_C	0.021	25.7	ERCC3/RAD25/XPB C-terminal helicase
4	PF00271 Helicase_C	9.9e-15	66.2	Helicase conserved C-terminal domain
5	PF03288 Pox_D5	88	15.0	Poxvirus D5 protein-like
6	PF04851 ResIII	4.4e-07	41.6	Type III restriction enzyme, res subunit
7	PF00176 SNF2-rel_dom	7.9e-60	214.0	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038869

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000048454	0.980	Uncharacterized protein
2	9598.ENSPTRP00000034497	0.771	MAK16 homolog
3	9598.ENSPTRP00000003664	0.750	Exonuclease 1
4	9598.ENSPTRP00000016254	0.731	Uncharacterized protein
5	9598.ENSPTRP00000004420	0.700	Uncharacterized protein
6	9598.ENSPTRP00000028278	0.687	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
7	9598.ENSPTRP00000030444	0.663	Belongs to the histone H2A family.
8	9598.ENSPTRP00000060659	0.662	Histone deacetylase
9	9598.ENSPTRP00000017884	0.659	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
10	9598.ENSPTRP00000011947	0.656	Tumor protein p53 binding protein 1
11	9598.ENSPTRP00000007761	0.646	Uncharacterized protein
12	9598.ENSPTRP00000012754	0.645	Uncharacterized protein
13	9598.ENSPTRP00000037302	0.624	Polymerase (DNA directed), alpha 1, catalytic subunit
14	9598.ENSPTRP00000029337	0.622	Uncharacterized protein
15	9598.ENSPTRP00000046785	0.608	Chromodomain helicase DNA binding protein 1-like
16	9598.ENSPTRP00000028912	0.596	Superkiller viralicidic activity 2-like 2
17	9598.ENSPTRP00000004849	0.590	Helicase, lymphoid-specific
18	9598.ENSPTRP00000061185	0.585	Component of the post-replicative DNA mismatch repair system (MMR)
19	9598.ENSPTRP00000040536	0.569	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
20	9598.ENSPTRP00000009603	0.563	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0140658	0.999	ATP-dependent chromatin remodeler activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0090304	0.968	nucleic acid metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0044260	0.945	cellular macromolecule metabolic process
GO:0071840	0.939	cellular component organization or biogenesis
GO:0016043	0.919	cellular component organization
GO:0006325	0.883	chromatin organization
GO:0050896	0.882	response to stimulus
GO:0006302	0.873	double-strand break repair
GO:0051052	0.860	regulation of DNA metabolic process
GO:0000018	0.843	regulation of DNA recombination
GO:0098732	0.738	macromolecule deacylation
GO:0016570	0.701	histone modification
GO:0007049	0.699	cell cycle
GO:0022402	0.638	cell cycle process
GO:0035601	0.618	protein deacylation
GO:0006476	0.590	protein deacetylation
GO:0016575	0.542	histone deacetylation
GO:0048518	0.523	positive regulation of biological process
GO:0051304	0.523	chromosome separation
GO:0006338	0.471	chromatin remodeling
GO:0010468	0.442	regulation of gene expression
GO:0048519	0.397	negative regulation of biological process
GO:0048522	0.362	positive regulation of cellular process
GO:0051173	0.333	positive regulation of nitrogen compound metabolic process
GO:0010604	0.320	positive regulation of macromolecule metabolic process
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	0.997	chromosome
GO:0005654	0.995	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0000785	0.896	chromatin
GO:0000228	0.488	nuclear chromosome
GO:0090734	0.468	site of DNA damage
GO:0005737	0.418	cytoplasm
GO:0005657	0.406	replication fork
GO:0035861	0.381	site of double-strand break
GO:0043596	0.372	nuclear replication fork
GO:0005829	0.301	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]