StarFunc result for job id Q9H4M7

User Input

>input (779 residues)
MEGSRPRSSLSLASSASTISSLSSLSPKKPTRAVNKIHAFGKRGNALRRDPNLPVHIRGW
LHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFT
FTAEHPGMRTYVLAADTLEDLRGWLRALGRASRAEGDDYGQPRSPARPQPGEGPGGPGGP
PEVSRGEEGRISESPEVTRLSRGRGRPRLLTPSPTTDLHSGLQMRRARSPDLFTPLSRPP
SPLSLPRPRSAPARRPPAPSGDTAPPARPHTPLSRIDVRPPLDWGPQRQTLSRPPTPRRG
PPSEAGGGKPPRSPQHWSQEPRTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQ
SLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQATREAGAPGRAW
GRQRLLQDRLVSVRATLCHLTQERERVWDTYSGLEQELGTLRETLEYLLHLGSPQDRVSA
QQQLWMVEDTLAGLGGPQKPPPHTEPDSPSPVLQGEESSERESLPESLELSSPRSPETDW
GRPPGGDKDLASPHLGLGSPRVSRASSPEGRHLPSPQLGTKAPVARPRMSAQEQLERMRR
NQECGRPFPRPTSPRLLTLGRTLSPARRQPDVEQRPVVGHSGAQKWLRSSGSWSSPRNTT
PYLPTSEGHRERVLSLSQALATEASQWHRMMTGGNLDSQGDPLPGVPLPPSDPTRQETPP
PRSPPVANSGSTGFSRRGSGRGGGPTPWGPAWDAGIAPPVLPQDEGAWPLRVTLLQSSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4M7	1.000	1.000	0.000	779	1.000	1.000	Q9H4M7.pdb.gz	PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2
2	AFDB:Q9HAU0	0.172	0.125	5.400E-22	1116	0.282	0.197	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
3	AFDB:B4DJX4	0.171	0.138	1.184E-21	977	0.275	0.219	B4DJX4.pdb.gz	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
4	AFDB:E9PKC0	0.164	0.101	1.657E-21	1271	0.320	0.196	E9PKC0.pdb.gz	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
5	AFDB:A0A024RAY7	0.187	0.131	4.300E-21	1174	0.276	0.183	A0A024RAY7.pdb.gz
6	AFDB:G9CGD6	0.123	0.107	1.593E-10	899	0.104	0.090	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
7	AFDB:Q80VL0	0.128	0.240	2.230E-10	406	0.101	0.195	Q80VL0.pdb.gz	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
8	AFDB:C6JUQ2	0.126	0.136	8.995E-8	721	0.157	0.169	C6JUQ2.pdb.gz	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
9	AFDB:Q9UQC2	0.142	0.162	2.333E-7	676	0.151	0.175	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
10	PDB:3ljuX	0.119	0.242	5.147E-7	373	0.031	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
11	AFDB:D3ZAL7	0.127	0.142	7.162E-7	693	0.132	0.149	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
12	PDB:6bbpA	0.115	0.171	1.335E-6	520	0.033	0.050	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
13	PDB:6u3eA	0.113	0.218	8.032E-6	397	0.033	0.065	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
14	PDB:6hhgA	0.114	0.223	1.862E-5	386	0.026	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:4mk0A	0.124	0.151	4.831E-5	631	0.024	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:7rx9A	0.116	0.204	8.952E-5	432	0.027	0.049	7rx9A.pdb.gz
17	PDB:6s9wA	0.108	0.200	1.120E-4	411	0.028	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:4mt6A	0.124	0.238	1.253E-4	389	0.026	0.051	4mt6A.pdb.gz
19	PDB:4uudC	0.110	0.614	2.748E-4	113	0.033	0.230	4uudC.pdb.gz
20	PDB:3uzsA	0.117	0.148	4.552E-4	609	0.028	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4M7	0.0	1508	779	1.000	1.000	PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2
2	D3ZRT6	6.31e-46	180	1190	0.109	0.071	D3ZRT6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=3
3	A0A0G2K6Z8	6.75e-46	179	1159	0.109	0.073	A0A0G2K6Z8_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=2
4	A0A8I6A7D6	1.02e-45	179	1218	0.109	0.070	A0A8I6A7D6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
5	A0A8I6A229	1.26e-45	179	1054	0.109	0.081	A0A8I6A229_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
6	A0A8I6GKY3	1.32e-45	179	1264	0.109	0.067	A0A8I6GKY3_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
7	A0A8I6A1V7	1.51e-45	179	1274	0.109	0.067	A0A8I6A1V7_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
8	Q3UIL6	1.54e-45	178	1118	0.109	0.076	PKHA7_MOUSE Pleckstrin homology domain-containing family A member 7 OS=Mus musculus OX=10090 GN=Plekha7 PE=1 SV=2
9	A0A8I5ZXL6	2.14e-45	178	1116	0.109	0.076	A0A8I5ZXL6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
10	B6RSP1	5.42e-45	177	1197	0.094	0.061	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
11	A0A1B0GTN9	5.54e-45	177	1192	0.108	0.070	A0A1B0GTN9_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
12	E9PKC0	5.97e-45	177	1271	0.108	0.066	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
13	Q6IQ23	1.04e-44	176	1121	0.108	0.075	PKHA7_HUMAN Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2
14	A0A0N4SUV0	2.78e-39	155	525	0.114	0.170	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
15	A0A0N4SW19	6.09e-39	154	531	0.090	0.132	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	A0A0N4SUU0	1.13e-38	157	956	0.114	0.093	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
17	Q9HAU0	1.23e-38	157	1116	0.090	0.063	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
18	B4DJX4	1.36e-38	157	977	0.090	0.072	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
19	A0A0N4SWD7	1.68e-38	156	1000	0.114	0.089	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
20	Q6ZPK1	2.53e-38	156	1205	0.090	0.058	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.8e-12	59.0	PH domain
2	PF15413 PH_11	0.48	22.3	Pleckstrin homology domain
3	PF15409 PH_8	34	16.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265970	0.752	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
2	9606.ENSP00000340914	0.691	Synaptotagmin-3
3	9606.ENSP00000477437	0.667	G protein-activated inward rectifier potassium channel 2
4	9606.ENSP00000353362	0.662	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
5	9606.ENSP00000308535	0.660	Vesicle transport protein GOT1A
6	9606.ENSP00000356156	0.660	Protein phosphatase 1 regulatory subunit 15B
7	9606.ENSP00000356230	0.657	Kelch-like protein 12
8	9606.ENSP00000234313	0.645	Pleckstrin
9	9606.ENSP00000344101	0.637	Olfactory receptor 6N2
10	9606.ENSP00000380594	0.636	BPI fold containing family C
11	9606.ENSP00000265969	0.607	Potassium voltage-gated channel subfamily C member 1
12	9606.ENSP00000357986	0.593	Pleckstrin homology domain-containing family A member 1
13	9606.ENSP00000356155	0.581	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
14	9606.ENSP00000384651	0.544	Myotubularin-related protein 3
15	9606.ENSP00000272203	0.530	Pleckstrin homology domain containing A6
16	9606.ENSP00000404296	0.525	Pleckstrin homology domain containing A5
17	9606.ENSP00000234453	0.519	Pleckstrin homology domain-containing family A member 3
18	9606.ENSP00000398273	0.515	Transcription factor SOX-5
19	9606.ENSP00000360423	0.502	Voltage-dependent N-type calcium channel subunit alpha-1B
20	9606.ENSP00000423276	0.502	Zinc finger CCHC-type containing 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	0.996	phosphatidylinositol-3-phosphate binding
GO:0080025	0.996	phosphatidylinositol-3,5-bisphosphate binding
GO:0043325	0.921	phosphatidylinositol-3,4-bisphosphate binding
GO:0005546	0.918	phosphatidylinositol-4,5-bisphosphate binding
GO:0042802	0.915	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0023051	0.979	regulation of signaling
GO:0010646	0.979	regulation of cell communication
GO:0009966	0.972	regulation of signal transduction
GO:0048522	0.896	positive regulation of cellular process
GO:2000027	0.876	regulation of animal organ morphogenesis
GO:0090175	0.872	regulation of establishment of planar polarity
GO:2000050	0.844	regulation of non-canonical Wnt signaling pathway
GO:0048584	0.815	positive regulation of response to stimulus
GO:0009987	0.796	cellular process
GO:0009967	0.736	positive regulation of signal transduction
GO:0030177	0.648	positive regulation of Wnt signaling pathway
GO:0090263	0.484	positive regulation of canonical Wnt signaling pathway
GO:0050896	0.316	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005622	0.975	intracellular anatomical structure
GO:0043226	0.974	organelle
GO:0043229	0.962	intracellular organelle
GO:0043227	0.960	membrane-bounded organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005829	0.942	cytosol
GO:0019897	0.905	extrinsic component of plasma membrane
GO:0031234	0.904	extrinsic component of cytoplasmic side of plasma membrane
GO:0005634	0.414	nucleus
GO:0032991	0.398	protein-containing complex
GO:0043232	0.309	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]