StarFunc result for job id Q9H4P4

User Input

>input (317 residues)
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7ZW16	0.837	0.834	6.502E-63	318	0.905	0.903	Q7ZW16.pdb.gz	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
2	AFDB:Q9VUV7	0.574	0.577	2.337E-50	315	0.571	0.575	Q9VUV7.pdb.gz	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
3	AFDB:Q69ZS0	0.352	0.112	1.734E-15	1063	0.224	0.067	Q69ZS0.pdb.gz	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
4	AFDB:Q9CQ29	0.337	0.431	2.788E-14	239	0.180	0.238	Q9CQ29.pdb.gz	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
5	AFDB:Q2KHN1	0.292	0.365	2.882E-13	245	0.180	0.233	Q2KHN1.pdb.gz	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
6	AFDB:A0A024QZ59	0.337	0.235	4.084E-12	470	0.120	0.081	A0A024QZ59.pdb.gz
7	AFDB:F6SA91	0.337	0.251	5.256E-12	437	0.123	0.089	F6SA91.pdb.gz	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
8	AFDB:Q7T1K2	0.338	0.236	1.194E-11	470	0.117	0.079	Q7T1K2.pdb.gz	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
9	AFDB:Q6ZMN7	0.346	0.111	1.637E-11	1036	0.132	0.041	Q6ZMN7.pdb.gz	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
10	AFDB:Q9Y4K3	0.314	0.193	4.495E-11	522	0.189	0.115	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
11	PDB:5dkaA	0.224	0.621	4.693E-5	96	0.076	0.250	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.197	0.244	6.041E-5	254	0.098	0.122	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:3m62A	0.197	0.068	1.609E-3	955	0.041	0.014	3m62A.pdb.gz
14	PDB:7qcdC	0.178	0.210	3.025E-3	267	0.057	0.067	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:5lj5t	0.153	0.112	5.339E-3	438	0.035	0.025	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
16	PDB:2c2lA	0.197	0.221	5.687E-3	281	0.044	0.050	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
17	PDB:2lgvA	0.133	0.388	6.873E-3	100	0.054	0.170	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
18	PDB:5gmkq	0.164	0.135	8.847E-3	387	0.079	0.065	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
19	PDB:7jzvA	0.179	0.222	9.423E-3	253	0.060	0.075	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
20	PDB:3jb9U	0.162	0.121	1.069E-2	430	0.101	0.074	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7ZW16	0.0	617	318	0.905	0.903	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
2	Q8BH75	0.0	659	317	0.997	0.997	RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus OX=10090 GN=Rnf41 PE=1 SV=1
3	Q9H4P4	0.0	660	317	1.000	1.000	RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens OX=9606 GN=RNF41 PE=1 SV=2
4	Q9VUV7	5.15e-146	415	315	0.571	0.575	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
5	Q69ZS0	2.31e-22	100	1063	0.218	0.065	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
6	Q2KHN1	1.02e-16	80.1	245	0.148	0.192	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
7	Q9CQ29	4.65e-16	78.2	239	0.158	0.209	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
8	Q6ZMN7	3.35e-15	78.6	1036	0.129	0.040	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
9	Q7T1K2	1.37e-12	70.1	470	0.126	0.085	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
10	Q9BUZ4	4.58e-11	65.5	470	0.126	0.085	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
11	Q61382	7.16e-11	65.1	470	0.129	0.087	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
12	F6SA91	7.89e-11	64.7	437	0.126	0.092	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
13	Q6IWL4	3.36e-10	63.2	542	0.136	0.079	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
14	Q3MV19	4.64e-10	62.8	556	0.148	0.085	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
15	Q6DJN2	4.76e-10	62.8	556	0.148	0.085	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
16	A4VCF7	1.12e-09	61.6	678	0.085	0.040	A4VCF7_DANRE Ligand of numb-protein X 2b OS=Danio rerio OX=7955 GN=lnxL PE=1 SV=1
17	Q91XL2	6.39e-09	59.3	687	0.095	0.044	LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus OX=10090 GN=Lnx2 PE=1 SV=2
18	B5DF45	2.03e-08	57.8	530	0.129	0.077	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
19	Q9UAC4	3.12e-08	57.0	475	0.107	0.072	Q9UAC4_DROME TRAF6 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
20	Q9W3I9	3.36e-08	57.0	475	0.107	0.072	Q9W3I9_DROME GH01161p OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	4.6e+02	12.6	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF04740 LXG	1.8e+02	13.3	LXG domain of WXG superfamily
3	PF16454 PI3K_P85_iSH2	62	14.6	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
4	PF03145 Sina	0.015	26.8	Seven in absentia protein family
5	PF04102 SlyX	3.1e+02	13.4	SlyX
6	PF08954 Trimer_CC	14	16.8	Trimerisation motif
7	PF04564 U-box	0.54	21.8	U-box domain
8	PF08941 USP8_interact	2e-82	286.8	USP8 interacting
9	PF12861 zf-ANAPC11	2.5	19.6	Anaphase-promoting complex subunit 11 RING-H2 finger
10	PF00097 zf-C3HC4	4.9e-05	34.4	Zinc finger, C3HC4 type (RING finger)
11	PF13923 zf-C3HC4_2	5.4e-06	37.4	Zinc finger, C3HC4 type (RING finger)
12	PF13920 zf-C3HC4_3	0.026	25.7	Zinc finger, C3HC4 type (RING finger)
13	PF15227 zf-C3HC4_4	0.0076	27.7	zinc finger of C3HC4-type, RING
14	PF18585 zf-CCCH_6	7.9e+02	11.4	Chromatin remodeling factor Mit1 C-terminal Zn finger 2
15	PF11789 zf-Nse	0.052	24.8	Zinc-finger of the MIZ type in Nse subunit
16	PF12678 zf-rbx1	0.02	26.5	RING-H2 zinc finger domain
17	PF16685 zf-RING_10	32	16.1	zinc RING finger of MSL2
18	PF17120 zf-RING_16	83	14.2	RING/Ubox like zinc-binding domain
19	PF13639 zf-RING_2	0.00059	31.4	Ring finger domain
20	PF14634 zf-RING_5	0.075	24.3	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006859489.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006831719.1	0.994	Ubiquitin carboxyl-terminal hydrolase 8
2	185453.XP_006859474.1	0.962	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins
3	185453.XP_006861927.1	0.936	Epidermal growth factor receptor
4	185453.XP_006872807.1	0.909	Receptor tyrosine-protein kinase erbB-4-like isoform X1
5	185453.XP_006833976.1	0.882	Ubiquitin carboxyl-terminal hydrolase 2 isoform X1
6	185453.XP_006861728.1	0.882	Ubiquitin carboxyl-terminal hydrolase 21
7	185453.XP_006832622.1	0.881	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 35 Proteins
8	185453.XP_006833973.1	0.881	E3 ubiquitin-protein ligase CBL
9	185453.XP_006872348.1	0.881	E3 ubiquitin-protein ligase CBL-B isoform X1
10	185453.XP_006831682.1	0.879	E3 ubiquitin-protein ligase NEDD4 isoform X1
11	185453.XP_006859325.1	0.875	NEDD4-like E3 ubiquitin-protein ligase WWP1
12	185453.XP_006876942.1	0.875	E3 ubiquitin-protein ligase Itchy homolog
13	185453.XP_006864961.1	0.869	TNF receptor-associated factor 6
14	185453.XP_006837584.1	0.866	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 32 Proteins
15	185453.XP_006870760.1	0.858	Insulin-like growth factor 1 receptor-like
16	185453.XP_006871544.1	0.856	E3 ubiquitin-protein ligase CBL-C
17	185453.XP_006873527.1	0.849	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 mRNAs, 52 Proteins
18	185453.XP_006831476.1	0.848	Fibroblast growth factor receptor 2 isoform X1
19	185453.XP_006868121.1	0.848	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
20	185453.XP_006874167.1	0.847	Fibroblast growth factor receptor 3 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.991	ubiquitin protein ligase activity
GO:0005126	0.970	cytokine receptor binding
GO:0042802	0.858	identical protein binding
GO:0019899	0.844	enzyme binding
GO:0070851	0.753	growth factor receptor binding
GO:0019900	0.401	kinase binding
GO:0019901	0.378	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0050794	0.997	regulation of cellular process
GO:0043170	0.996	macromolecule metabolic process
GO:0019222	0.996	regulation of metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0009894	0.994	regulation of catabolic process
GO:0048519	0.987	negative regulation of biological process
GO:0000209	0.987	protein polyubiquitination
GO:0009987	0.986	cellular process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0048523	0.975	negative regulation of cellular process
GO:0048518	0.964	positive regulation of biological process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0048522	0.923	positive regulation of cellular process
GO:0010506	0.897	regulation of autophagy
GO:0051171	0.893	regulation of nitrogen compound metabolic process
GO:0080090	0.863	regulation of primary metabolic process
GO:0051128	0.841	regulation of cellular component organization
GO:0010821	0.815	regulation of mitochondrion organization
GO:0044237	0.801	cellular metabolic process
GO:0048583	0.764	regulation of response to stimulus
GO:0023051	0.763	regulation of signaling
GO:0050896	0.715	response to stimulus
GO:0031324	0.711	negative regulation of cellular metabolic process
GO:0051239	0.694	regulation of multicellular organismal process
GO:0009893	0.667	positive regulation of metabolic process
GO:0009966	0.666	regulation of signal transduction
GO:0051246	0.664	regulation of protein metabolic process
GO:0002682	0.654	regulation of immune system process
GO:0007154	0.644	cell communication
GO:1902531	0.639	regulation of intracellular signal transduction
GO:0045595	0.609	regulation of cell differentiation
GO:0023052	0.539	signaling
GO:0051716	0.537	cellular response to stimulus
GO:0051173	0.532	positive regulation of nitrogen compound metabolic process
GO:0010604	0.530	positive regulation of macromolecule metabolic process
GO:0007165	0.515	signal transduction
GO:0006508	0.466	proteolysis
GO:0060284	0.446	regulation of cell development
GO:0048584	0.421	positive regulation of response to stimulus
GO:0051247	0.342	positive regulation of protein metabolic process
GO:0031325	0.341	positive regulation of cellular metabolic process
GO:0009056	0.333	catabolic process
GO:0008219	0.328	cell death
GO:0009967	0.319	positive regulation of signal transduction
GO:0042127	0.318	regulation of cell population proliferation
GO:1901565	0.310	organonitrogen compound catabolic process
GO:2000377	0.305	regulation of reactive oxygen species metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005783	0.943	endoplasmic reticulum
GO:0098827	0.893	endoplasmic reticulum subcompartment
GO:0071782	0.823	endoplasmic reticulum tubular network
GO:0048471	0.807	perinuclear region of cytoplasm
GO:0005634	0.749	nucleus
GO:0031981	0.726	nuclear lumen
GO:0016020	0.574	membrane
GO:0005654	0.423	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]