StarFunc result for job id Q9H4Q3

User Input

>input (707 residues)
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQG
AVPAADGLGLSPKPPAPDFAAPSQAGTLRPHPLGPPPVQACGAREGIKREASSAPSATSP
TPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSAGVGSLAFYPGVRSAFKPAGL
ARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGAGHHHHHHAHH
HHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGARY
AQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYY
PLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGR
LDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKP
LKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLA
KAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PZZ1	0.441	0.416	4.746E-89	754	0.837	0.785	E9PZZ1.pdb.gz	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
2	AFDB:F1R7D7	0.250	0.284	1.100E-60	614	0.543	0.625	F1R7D7.pdb.gz	F1R7D7_DANRE PR domain zinc finger protein 13 OS=Danio rerio OX=7955 GN=prdm13 PE=4 SV=2
3	AFDB:A0A096MJU6	0.111	0.093	1.707E-12	857	0.164	0.135	A0A096MJU6.pdb.gz	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
4	AFDB:O75626	0.114	0.099	2.183E-12	825	0.191	0.164	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
5	AFDB:Q5EXX3	0.080	0.058	3.476E-9	1203	0.185	0.109	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
6	AFDB:P11161	0.109	0.155	3.696E-9	476	0.153	0.227	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
7	AFDB:M9NEG1	0.110	0.074	2.005E-7	1109	0.161	0.103	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
8	AFDB:Q8NAP3	0.107	0.070	4.192E-7	1195	0.154	0.091	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
9	AFDB:P41183	0.107	0.107	1.267E-6	707	0.139	0.139	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
10	AFDB:B9WEF9	0.106	0.106	2.342E-6	708	0.130	0.130	B9WEF9.pdb.gz	B9WEF9_CANDC Transcriptional regulator, putative OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CRZ1 PE=4 SV=1
11	PDB:3w5kB	0.056	0.229	3.346E-3	110	0.044	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2g46A	0.056	0.276	3.674E-2	119	0.011	0.067	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	PDB:5ex0A	0.057	0.092	1.044E-1	429	0.021	0.035	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
14	PDB:5h6zA	0.057	0.279	1.930E-1	123	0.018	0.106	5h6zA.pdb.gz
15	PDB:3qxyA	0.063	0.097	2.321E-1	420	0.017	0.029	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
16	PDB:3n71A	0.054	0.078	2.968E-1	468	0.018	0.028	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
17	PDB:1pegA	0.054	0.134	4.852E-1	266	0.024	0.064	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:5v3hA	0.054	0.085	6.203E-1	438	0.013	0.021	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
19	PDB:5hynA	0.058	0.070	7.931E-1	581	0.023	0.028	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
20	PDB:7td5F	0.057	0.087	8.434E-1	447	0.024	0.038	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PZZ1	0.0	970	754	0.822	0.771	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
2	F1R7D7	0.0	673	614	0.549	0.632	F1R7D7_DANRE PR domain zinc finger protein 13 OS=Danio rerio OX=7955 GN=prdm13 PE=4 SV=2
3	B7ZRU9	1.32e-15	83.6	1055	0.054	0.036	EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1
4	Q8I7Z8	1.81e-15	83.2	990	0.058	0.041	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
5	Q03112	2.13e-15	82.8	1230	0.052	0.030	MECOM_HUMAN Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3
6	P14404	2.15e-15	82.8	1232	0.052	0.030	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
7	A0A0C3SFZ7	2.19e-15	82.8	1052	0.052	0.035	A0A0C3SFZ7_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
8	E7EUL6	2.52e-15	82.4	1003	0.052	0.037	E7EUL6_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
9	Q9HAZ2	3.17e-15	82.4	1276	0.052	0.029	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
10	D6RDW0	3.38e-15	82.4	1178	0.052	0.031	D6RDW0_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
11	D6RFY3	3.41e-15	82.4	1177	0.052	0.031	D6RFY3_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
12	Q9VGL2	4.25e-15	80.1	377	0.047	0.088	Q9VGL2_DROME GM08392p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG14711 PE=2 SV=1
13	H0YA13	4.45e-15	82.0	1084	0.052	0.034	H0YA13_HUMAN PR/SET domain 16 (Fragment) OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
14	Q9N658	4.99e-15	80.9	541	0.052	0.068	GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster OX=7227 GN=sens PE=1 SV=1
15	M9PFM9	5.01e-15	81.3	686	0.052	0.054	M9PFM9_DROME Crooked legs, isoform H OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
16	M9PD94	7.17e-15	80.9	907	0.052	0.041	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
17	A2A935	7.28e-15	81.3	1275	0.047	0.026	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
18	P23803	1.43e-14	78.6	392	0.050	0.089	ODD_DROME Protein odd-skipped OS=Drosophila melanogaster OX=7227 GN=odd PE=2 SV=3
19	Q99684	1.60e-14	78.6	422	0.071	0.118	GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2
20	Q13360	1.61e-14	79.0	481	0.066	0.098	ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens OX=9606 GN=ZNF177 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08193 INO80_Ies4	8.4e+02	11.4	INO80 complex subunit Ies4
2	PF00856 SET	6.4	18.6	SET domain
3	PF02892 zf-BED	7.3	18.0	BED zinc finger
4	PF00096 zf-C2H2	7.9e-15	65.5	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	1.2e+02	14.4	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	0.093	24.6	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	0.37	22.4	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	0.00078	31.0	Zinc-finger double domain
9	PF13909 zf-H2C2_5	18	16.5	C2H2-type zinc-finger domain
10	PF12874 zf-met	1.3	20.7	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000235372	0.705	PR domain zinc finger protein 2
2	9606.ENSP00000296921	0.689	T-cell leukemia homeobox protein 3
3	9606.ENSP00000480626	0.672	PR domain-containing protein 11
4	9606.ENSP00000266744	0.662	Achaete-scute homolog 1
5	9606.ENSP00000462269	0.642	Zinc finger protein 488
6	9606.ENSP00000359215	0.601	T-cell leukemia homeobox protein 1
7	9606.ENSP00000374152	0.550	SET and MYND domain-containing protein 5
8	9606.ENSP00000396732	0.526	Probable histone-lysine N-methyltransferase PRDM7
9	9606.ENSP00000318799	0.523	Class E basic helix-loop-helix protein 22
10	9606.ENSP00000365687	0.515	Pancreas transcription factor 1 subunit alpha
11	9606.ENSP00000385852	0.501	SET domain-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042054	0.997	histone methyltransferase activity
GO:0003682	0.995	chromatin binding
GO:0140297	0.989	DNA-binding transcription factor binding
GO:0061629	0.930	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003676	0.856	nucleic acid binding
GO:0003677	0.845	DNA binding
GO:0140110	0.798	transcription regulator activity
GO:0043565	0.798	sequence-specific DNA binding
GO:0000981	0.791	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.785	double-stranded DNA binding
GO:1990837	0.777	sequence-specific double-stranded DNA binding
GO:0016278	0.737	lysine N-methyltransferase activity
GO:0000976	0.728	transcription cis-regulatory region binding
GO:0016279	0.705	protein-lysine N-methyltransferase activity
GO:0018024	0.704	histone lysine N-methyltransferase activity
GO:0000977	0.671	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0009987	0.980	cellular process
GO:0048523	0.976	negative regulation of cellular process
GO:0019219	0.942	regulation of nucleobase-containing compound metabolic process
GO:0031324	0.934	negative regulation of cellular metabolic process
GO:0051172	0.932	negative regulation of nitrogen compound metabolic process
GO:0010468	0.931	regulation of gene expression
GO:0009890	0.931	negative regulation of biosynthetic process
GO:0010605	0.926	negative regulation of macromolecule metabolic process
GO:0045892	0.906	negative regulation of DNA-templated transcription
GO:0032501	0.867	multicellular organismal process
GO:0032502	0.863	developmental process
GO:0006357	0.816	regulation of transcription by RNA polymerase II
GO:0000122	0.811	negative regulation of transcription by RNA polymerase II
GO:0048856	0.802	anatomical structure development
GO:0007417	0.723	central nervous system development
GO:0060322	0.700	head development
GO:0048869	0.686	cellular developmental process
GO:0048513	0.678	animal organ development
GO:0030154	0.604	cell differentiation
GO:0022008	0.441	neurogenesis
GO:0048699	0.430	generation of neurons
GO:0030182	0.422	neuron differentiation
GO:0007420	0.401	brain development
GO:0030900	0.342	forebrain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.975	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.998	Methyltransferases.
RHEA:51736	0.705	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]