StarFunc result for job id Q9H4R4

User Input

>input (102 residues)
MSSSGYPPNQGAFSTEQSHYPPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQ
NASPSKLSKEELIECMDRVDREIAKVEQQILKLKKKQVKVFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYN2	0.235	0.214	1.564	117	0.245	0.214	Q8IYN2.pdb.gz	TCAL8_HUMAN Transcription elongation factor A protein-like 8 OS=Homo sapiens OX=9606 GN=TCEAL8 PE=1 SV=1
2	AFDB:Q54G01	0.200	0.052	1.811	470	0.157	0.034	Q54G01.pdb.gz	Q54G01_DICDI Centrosomal protein 55 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290509 PE=4 SV=1
3	AFDB:Q8IIB6	0.364	0.128	1.948	301	0.186	0.063	Q8IIB6.pdb.gz	Q8IIB6_PLAF7 GrpE protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124700 PE=3 SV=2
4	AFDB:P13903	0.278	0.176	2.256	166	0.176	0.108	P13903.pdb.gz	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
5	AFDB:Q9M5P2	0.302	0.117	2.256	289	0.147	0.052	Q9M5P2.pdb.gz	SCAM3_ARATH Secretory carrier-associated membrane protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCAMP3 PE=1 SV=1
6	AFDB:Q568M7	0.275	0.173	2.427	169	0.176	0.107	Q568M7.pdb.gz	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
7	AFDB:Q9XZS8	0.288	0.060	2.427	613	0.167	0.028	Q9XZS8.pdb.gz	ATF3_DROME Activating transcription factor 3 OS=Drosophila melanogaster OX=7227 GN=Atf3 PE=1 SV=1
8	AFDB:O35426	0.274	0.116	2.810	267	0.186	0.071	O35426.pdb.gz	XBP1_MOUSE X-box-binding protein 1 OS=Mus musculus OX=10090 GN=Xbp1 PE=1 SV=2
9	AFDB:O75081	0.329	0.062	3.254	653	0.137	0.021	O75081.pdb.gz	MTG16_HUMAN Protein CBFA2T3 OS=Homo sapiens OX=9606 GN=CBFA2T3 PE=1 SV=2
10	AFDB:Q9BXF6	0.379	0.062	3.254	653	0.206	0.032	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
11	PDB:6cxcB	0.233	0.071	4.738	358	0.108	0.031	6cxcB.pdb.gz
12	PDB:8ap7N	0.190	0.150	6.352	139	0.078	0.058	8ap7N.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
13	PDB:7aqwl	0.247	0.365	7.354	66	0.029	0.045	7aqwl.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
14	PDB:6qw64A	0.280	0.125	7.913	239	0.108	0.046	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:7nacI	0.199	0.044	7.913	533	0.118	0.023	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:6hivAg	0.247	0.101	8.514	259	0.088	0.035	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:6qw65X	0.297	0.062	9.161	583	0.137	0.024	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:7a6hQ	0.186	0.182	9.857	104	0.088	0.087	7a6hQ.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75376	1.37e-28	109	2440	0.510	0.021	NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2
2	E7EVU5	1.52e-28	109	537	0.510	0.097	E7EVU5_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
3	J3KS51	1.60e-28	109	546	0.510	0.095	J3KS51_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
4	E7EW50	1.80e-28	108	545	0.510	0.095	E7EW50_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
5	Q60974	3.25e-27	105	2453	0.490	0.020	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
6	C9JAP0	2.75e-16	70.5	125	0.314	0.256	C9JAP0_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
7	A8B6H7	4.86e-16	73.9	2409	0.412	0.017	A8B6H7_DANRE Nuclear receptor co-repressor OS=Danio rerio OX=7955 GN=ncor PE=1 SV=1
8	E7FF48	1.36e-11	61.2	2315	0.314	0.014	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
9	A0A8I6A620	6.27e-11	59.3	2464	0.353	0.015	A0A8I6A620_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
10	D3ZXN9	6.58e-11	59.3	2477	0.353	0.015	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
11	A0A0G2JU91	6.78e-11	59.3	2511	0.353	0.014	A0A0G2JU91_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
12	A0A8I6AN60	6.84e-11	59.3	2453	0.353	0.015	A0A8I6AN60_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
13	Q9WU42	7.18e-11	59.3	2472	0.353	0.015	NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus OX=10090 GN=Ncor2 PE=1 SV=3
14	C9J0Q5	1.41e-09	55.5	2504	0.265	0.011	C9J0Q5_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=2
15	Q9Y618	1.47e-09	55.5	2514	0.265	0.011	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
16	C9JE98	1.48e-09	55.5	2458	0.265	0.011	C9JE98_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
17	C9JQE8	2.81e-09	54.7	1451	0.265	0.019	C9JQE8_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
18	P20288	0.035	34.7	444	0.206	0.047	DRD2_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=2 SV=1
19	Q17740	0.36	31.6	641	0.176	0.028	Q17740_CAEEL ALG-1 INteracting protein OS=Caenorhabditis elegans OX=6239 GN=ain-1 PE=1 SV=4
20	F4IXW2	2.9	29.3	1739	0.137	0.008	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15784 GPS2_interact	1.1e-16	72.2	G-protein pathway suppressor 2-interacting domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000584

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012796	0.948	Peroxisome proliferator-activated receptor gamma
2	9593.ENSGGOP00000015976	0.945	Histone deacetylase 3
3	9593.ENSGGOP00000003063	0.935	Retinoic acid receptor, alpha
4	9593.ENSGGOP00000011448	0.915	Peroxisome proliferator-activated receptor alpha
5	9593.ENSGGOP00000007381	0.911	Transducin (beta)-like 1X-linked
6	9593.ENSGGOP00000026804	0.910	Histone deacetylase
7	9593.ENSGGOP00000009444	0.909	Nuclear receptor subfamily 1, group D, member 1
8	9593.ENSGGOP00000009311	0.904	Transducin (beta)-like 1 X-linked receptor 1
9	9593.ENSGGOP00000028316	0.901	B-cell CLL/lymphoma 6
10	9593.ENSGGOP00000004436	0.889	Uncharacterized protein
11	9593.ENSGGOP00000009438	0.886	Thyroid hormone receptor, alpha
12	9593.ENSGGOP00000011454	0.883	Histone deacetylase 1
13	9593.ENSGGOP00000010106	0.878	Uncharacterized protein
14	9593.ENSGGOP00000009454	0.868	Estrogen receptor
15	9593.ENSGGOP00000005320	0.864	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
16	9593.ENSGGOP00000004495	0.856	Recombination signal binding protein for immunoglobulin kappa J region
17	9593.ENSGGOP00000008032	0.856	E1A binding protein p300
18	9593.ENSGGOP00000009200	0.855	Nuclear receptor corepressor 2
19	9593.ENSGGOP00000019129	0.848	Histone deacetylase
20	9593.ENSGGOP00000008392	0.843	Nuclear receptor subfamily 1, group H, member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140297	0.953	DNA-binding transcription factor binding
GO:0061629	0.704	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003712	0.489	transcription coregulator activity
GO:0043565	0.489	sequence-specific DNA binding
GO:0003682	0.478	chromatin binding
GO:0016922	0.439	nuclear receptor binding
GO:0003824	0.371	catalytic activity
GO:0003714	0.361	transcription corepressor activity
GO:0019899	0.342	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048731	0.994	system development
GO:0009987	0.986	cellular process
GO:0065007	0.917	biological regulation
GO:0050789	0.911	regulation of biological process
GO:0050794	0.896	regulation of cellular process
GO:0019222	0.894	regulation of metabolic process
GO:0048869	0.847	cellular developmental process
GO:0060255	0.844	regulation of macromolecule metabolic process
GO:0031323	0.843	regulation of cellular metabolic process
GO:0080090	0.831	regulation of primary metabolic process
GO:0030154	0.828	cell differentiation
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0010468	0.820	regulation of gene expression
GO:0048513	0.819	animal organ development
GO:0031326	0.818	regulation of cellular biosynthetic process
GO:0010556	0.809	regulation of macromolecule biosynthetic process
GO:0006355	0.798	regulation of DNA-templated transcription
GO:0048518	0.727	positive regulation of biological process
GO:0007399	0.720	nervous system development
GO:0048519	0.684	negative regulation of biological process
GO:0048523	0.636	negative regulation of cellular process
GO:0009893	0.584	positive regulation of metabolic process
GO:0006357	0.576	regulation of transcription by RNA polymerase II
GO:0048522	0.549	positive regulation of cellular process
GO:0050896	0.539	response to stimulus
GO:0007417	0.530	central nervous system development
GO:0031325	0.508	positive regulation of cellular metabolic process
GO:0051173	0.500	positive regulation of nitrogen compound metabolic process
GO:0010604	0.499	positive regulation of macromolecule metabolic process
GO:0008152	0.475	metabolic process
GO:0060322	0.470	head development
GO:0009892	0.466	negative regulation of metabolic process
GO:0010605	0.462	negative regulation of macromolecule metabolic process
GO:0007420	0.454	brain development
GO:0071704	0.440	organic substance metabolic process
GO:0010558	0.427	negative regulation of macromolecule biosynthetic process
GO:0031327	0.426	negative regulation of cellular biosynthetic process
GO:0051172	0.425	negative regulation of nitrogen compound metabolic process
GO:1903507	0.416	negative regulation of nucleic acid-templated transcription
GO:0045892	0.398	negative regulation of DNA-templated transcription
GO:0043170	0.377	macromolecule metabolic process
GO:0048468	0.374	cell development
GO:0000122	0.357	negative regulation of transcription by RNA polymerase II
GO:0030097	0.348	hemopoiesis
GO:0042221	0.339	response to chemical
GO:0030099	0.329	myeloid cell differentiation
GO:0002521	0.327	leukocyte differentiation
GO:0044238	0.326	primary metabolic process
GO:0051716	0.310	cellular response to stimulus
GO:0010033	0.308	response to organic substance
GO:0031328	0.308	positive regulation of cellular biosynthetic process
GO:0045935	0.308	positive regulation of nucleobase-containing compound metabolic process
GO:0030902	0.301	hindbrain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.994	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]