StarFunc result for job id Q9H4T2

User Input

>input (348 residues)
MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALT
QLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLE
RELDEPGKQVPGNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTR
TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQRERRRYKCDE
CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD
FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4T2	1.000	1.000	1.527E-57	348	1.000	1.000	Q9H4T2.pdb.gz	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
2	AFDB:Q8NF99	0.330	0.221	4.569E-29	534	0.486	0.316	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
3	AFDB:O15535	0.352	0.316	4.836E-29	394	0.491	0.434	O15535.pdb.gz	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
4	AFDB:O43309	0.314	0.184	3.143E-28	604	0.443	0.255	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
5	AFDB:Q96LW9	0.322	0.276	8.244E-28	406	0.480	0.411	Q96LW9.pdb.gz	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
6	AFDB:A0A024RC47	0.359	0.341	9.234E-28	368	0.468	0.443	A0A024RC47.pdb.gz
7	AFDB:Q9BRR0	0.326	0.217	9.234E-28	538	0.477	0.309	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
8	AFDB:Q86W11	0.376	0.275	3.039E-27	494	0.457	0.322	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
9	AFDB:P49910	0.295	0.216	2.623E-26	485	0.468	0.336	P49910.pdb.gz	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
10	AFDB:O14771	0.317	0.242	7.280E-26	459	0.428	0.325	O14771.pdb.gz	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
11	PDB:3w5kB	0.122	0.258	9.528E-5	110	0.115	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ylh7	0.075	0.056	1.387	547	0.066	0.042	6ylh7.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
13	PDB:5gm6a	0.057	0.132	1.644	123	0.063	0.179	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:6gejS	0.084	0.128	2.445	208	0.083	0.139	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:7k98A	0.097	0.098	2.588	343	0.063	0.064	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
16	PDB:6hivBI	0.100	0.107	2.739	319	0.049	0.053	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:8escS	0.089	0.104	3.637	268	0.072	0.093	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
18	PDB:6ylgt	0.097	0.084	3.849	431	0.086	0.070	6ylgt.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
19	PDB:3ismC	0.120	0.142	4.074	286	0.046	0.056	3ismC.pdb.gz
20	PDB:3rx6A	0.085	0.122	4.074	187	0.057	0.107	3rx6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4T2	0.0	718	348	1.000	1.000	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
2	Q96LW9	6.08e-113	336	406	0.523	0.448	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
3	Q3MJ62	6.63e-109	325	389	0.509	0.455	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
4	O15535	1.64e-104	314	394	0.500	0.442	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
5	P17028	8.00e-103	308	368	0.497	0.470	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
6	Q8NF99	7.67e-101	309	534	0.500	0.326	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
7	Q91VN1	4.00e-100	301	368	0.494	0.467	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
8	O43309	2.01e-96	300	611	0.486	0.277	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
9	Q9BRR0	3.01e-95	295	538	0.532	0.344	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
10	A0A0S2Z658	2.13e-89	280	545	0.509	0.325	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
11	Q969J2	2.13e-89	280	545	0.509	0.325	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
12	I3L4J6	3.44e-89	276	435	0.437	0.349	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
13	Q9UNY5	3.56e-88	273	417	0.477	0.398	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
14	Q3ZBY5	4.47e-88	274	466	0.474	0.354	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
15	Q9Y5A6	7.83e-88	274	473	0.466	0.342	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
16	Q96N95	9.74e-83	256	335	0.397	0.412	ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens OX=9606 GN=ZNF396 PE=1 SV=2
17	P49910	3.46e-82	259	485	0.477	0.342	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
18	Q53Z40	3.46e-82	259	485	0.477	0.342	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
19	Q16670	1.54e-77	247	478	0.443	0.322	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
20	A0A024RCN4	6.11e-77	246	479	0.445	0.324	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	6.5	18.1	Adenylate kinase, active site lid
2	PF00130 C1_1	0.54	21.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF07975 C1_4	1.7e+02	13.8	TFIIH C1-like domain
4	PF14353 CpXC	7.3e+02	11.6	CpXC protein
5	PF03604 DNA_RNApol_7kD	3.5e+02	12.3	DNA directed RNA polymerase, 7 kDa subunit
6	PF17522 DUF5446	5.2e+02	12.2	Family of unknown function (DUF5446)
7	PF20026 DUF6434	2.3e+02	13.2	Domain of unknown function (DUF6434)
8	PF12773 DZR	1.4	20.3	Double zinc ribbon
9	PF07754 HVO_2753_ZBP	0.21	22.7	Small zinc finger protein HVO_2753-like, Zn-binding pocket
10	PF01155 HypA	90	14.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
11	PF02023 SCAN	3.1e-39	144.0	SCAN domain
12	PF01096 TFIIS_C	59	14.9	Transcription factor S-II (TFIIS)
13	PF01286 XPA_N	0.012	27.0	XPA protein N-terminal
14	PF14149 YhfH	84	14.5	YhfH-like protein
15	PF01428 zf-AN1	88	14.7	AN1-like Zinc finger
16	PF00096 zf-C2H2	5.6e-21	84.9	Zinc finger, C2H2 type
17	PF16622 zf-C2H2_11	4	18.6	zinc-finger C2H2-type
18	PF13894 zf-C2H2_4	2.7e-11	54.3	C2H2-type zinc finger
19	PF13912 zf-C2H2_6	2.9e-06	38.4	C2H2-type zinc finger
20	PF15909 zf-C2H2_8	14	17.5	C2H2-type zinc ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380057	0.869	Zinc finger and SCAN domain-containing protein 32
2	9606.ENSP00000483936	0.726	Synaptotagmin-like protein 3
3	9606.ENSP00000472802	0.674	Zinc finger protein 446
4	9606.ENSP00000302144	0.636	Transmembrane protein 154
5	9606.ENSP00000316377	0.627	Disks large-associated protein 1
6	9606.ENSP00000187762	0.612	Trimeric intracellular cation channel type A
7	9606.ENSP00000321203	0.609	TNFAIP3-interacting protein 2
8	9606.ENSP00000351569	0.606	Small integral membrane protein 7
9	9606.ENSP00000263056	0.566	Mitogen-activated protein kinase kinase kinase 8
10	9606.ENSP00000345716	0.519	NKAP-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.995	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009889	0.996	regulation of biosynthetic process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0010468	0.984	regulation of gene expression
GO:2001141	0.977	regulation of RNA biosynthetic process
GO:0006355	0.962	regulation of DNA-templated transcription
GO:0051172	0.939	negative regulation of nitrogen compound metabolic process
GO:0048523	0.919	negative regulation of cellular process
GO:0010605	0.919	negative regulation of macromolecule metabolic process
GO:0031324	0.891	negative regulation of cellular metabolic process
GO:0051253	0.872	negative regulation of RNA metabolic process
GO:0010558	0.871	negative regulation of macromolecule biosynthetic process
GO:0031327	0.801	negative regulation of cellular biosynthetic process
GO:1902679	0.720	negative regulation of RNA biosynthetic process
GO:0009987	0.709	cellular process
GO:1903507	0.592	negative regulation of nucleic acid-templated transcription
GO:0048518	0.568	positive regulation of biological process
GO:0045892	0.496	negative regulation of DNA-templated transcription
GO:0006357	0.463	regulation of transcription by RNA polymerase II
GO:0048522	0.439	positive regulation of cellular process
GO:0009893	0.405	positive regulation of metabolic process
GO:0009891	0.349	positive regulation of biosynthetic process
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0010604	0.336	positive regulation of macromolecule metabolic process
GO:0031328	0.322	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.990	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0005737	0.644	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]