StarFunc result for job id Q9H4X1

User Input

>input (137 residues)
MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
KELEAFIADLDKTLASM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4X1	1.000	1.000	8.690E-20	137	1.000	1.000	Q9H4X1.pdb.gz	RGCC_HUMAN Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1
2	AFDB:Q9DBX1	0.421	0.421	5.858E-16	137	0.869	0.869	Q9DBX1.pdb.gz	RGCC_MOUSE Regulator of cell cycle RGCC OS=Mus musculus OX=10090 GN=Rgcc PE=1 SV=1
3	AFDB:Q585V5	0.210	0.068	2.802	489	0.146	0.041	Q585V5.pdb.gz	Q585V5_TRYB2 TPR-repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.25 PE=4 SV=1
4	AFDB:P34925	0.171	0.051	3.005	607	0.212	0.048	P34925.pdb.gz	RYK_HUMAN Tyrosine-protein kinase RYK OS=Homo sapiens OX=9606 GN=RYK PE=1 SV=3
5	AFDB:Q19788	0.160	0.069	4.263	390	0.131	0.046	Q19788.pdb.gz	Q19788_CAEEL H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Caenorhabditis elegans OX=6239 GN=CELE_F25H8.2 PE=1 SV=1
6	AFDB:D4A702	0.257	0.041	4.903	1262	0.182	0.020	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
7	AFDB:Q386T1	0.189	0.045	5.259	862	0.124	0.020	Q386T1.pdb.gz	Q386T1_TRYB2 BRO1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0002 PE=4 SV=1
8	AFDB:Q80V81	0.182	0.043	5.640	607	0.117	0.026	Q80V81.pdb.gz	Q80V81_MOUSE Zinc finger protein 819 OS=Mus musculus OX=10090 GN=Zfp819 PE=1 SV=1
9	AFDB:Q382Q8	0.171	0.157	6.487	150	0.168	0.153	Q382Q8.pdb.gz	Q382Q8_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4580 PE=4 SV=1
10	AFDB:A0A6L8PD99	0.165	0.126	6.957	204	0.124	0.083	A0A6L8PD99.pdb.gz	A0A6L8PD99_BACAN Spore germination protein GerPC OS=Bacillus anthracis OX=1392 GN=gerPC PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4X1	1.09e-93	268	137	1.000	1.000	RGCC_HUMAN Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1
2	Q9Z2P4	7.37e-67	200	137	0.891	0.891	RGCC_RAT Regulator of cell cycle RGCC OS=Rattus norvegicus OX=10116 GN=Rgcc PE=1 SV=1
3	Q9DBX1	3.89e-62	188	137	0.869	0.869	RGCC_MOUSE Regulator of cell cycle RGCC OS=Mus musculus OX=10090 GN=Rgcc PE=1 SV=1
4	A1Z651	0.17	33.5	1733	0.241	0.019	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
5	P08104	0.38	32.7	1951	0.168	0.012	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
6	A2ASI5	0.45	32.3	1947	0.168	0.012	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
7	C8VQ98	1.6	30.8	479	0.146	0.042	AUSM_EMENI FAD-dependent monooxygenase ausM OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ausM PE=3 SV=1
8	L7RKJ8	3.4	30.0	1299	0.219	0.023	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
9	P09377	3.8	29.3	278	0.117	0.058	RHAS_ECOLI HTH-type transcriptional activator RhaS OS=Escherichia coli (strain K12) OX=83333 GN=rhaS PE=1 SV=1
10	O13713	4.7	29.3	307	0.175	0.078	NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nab2 PE=3 SV=1
11	Q6SJR1	5.2	29.3	720	0.124	0.024	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1
12	Q9Y6F6	6.1	29.3	904	0.219	0.033	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4
13	A0A1B0GVX7	7.3	28.9	1618	0.117	0.010	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
14	A0A1W2PPJ3	7.3	28.9	1998	0.117	0.008	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
15	A0A286YF26	7.3	28.9	1997	0.117	0.008	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
16	P35498	7.3	28.9	2009	0.117	0.008	SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=2
17	Q70EL1	7.9	28.9	1684	0.124	0.010	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
18	A0A286YEQ8	8.5	28.9	1915	0.117	0.008	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
19	Q76KB2	9.6	28.5	408	0.117	0.039	H6ST1_CHICK Heparan-sulfate 6-O-sulfotransferase 1 OS=Gallus gallus OX=9031 GN=HS6ST1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19531 DUF6058	4.3e+02	12.5	Family of unknown function (DUF6058)
2	PF15151 RGCC	9e-60	212.0	Response gene to complement 32 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332973	0.923	Mothers against decapentaplegic homolog 3
2	9606.ENSP00000269305	0.918	Cellular tumor antigen p53
3	9606.ENSP00000262160	0.765	Mothers against decapentaplegic homolog 2
4	9606.ENSP00000300093	0.756	Serine/threonine-protein kinase PLK1
5	9606.ENSP00000378699	0.730	Cyclin-dependent kinase 1
6	9606.ENSP00000358966	0.672	Interphotoreceptor matrix proteoglycan 1
7	9606.ENSP00000264228	0.664	Polyprenol reductase
8	9606.ENSP00000304987	0.642	Phakinin
9	9606.ENSP00000252456	0.635	Calponin-1
10	9606.ENSP00000325561	0.598	Transmembrane channel-like protein 8
11	9606.ENSP00000432282	0.584	Transgelin
12	9606.ENSP00000245157	0.566	Bardet-Biedl syndrome 2 protein
13	9606.ENSP00000402373	0.560	Actin, aortic smooth muscle
14	9606.ENSP00000322180	0.526	Sister chromatid cohesion protein DCC1
15	9606.ENSP00000377060	0.501	Chromobox protein homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0140677	0.926	molecular function activator activity
GO:0070412	0.921	R-SMAD binding
GO:0030295	0.898	protein kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048518	0.977	positive regulation of biological process
GO:0048522	0.961	positive regulation of cellular process
GO:0080090	0.925	regulation of primary metabolic process
GO:0051171	0.915	regulation of nitrogen compound metabolic process
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0060255	0.900	regulation of macromolecule metabolic process
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0009889	0.889	regulation of biosynthetic process
GO:0019219	0.886	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.883	regulation of macromolecule biosynthetic process
GO:0031326	0.883	regulation of cellular biosynthetic process
GO:0010604	0.882	positive regulation of macromolecule metabolic process
GO:0045935	0.875	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.873	positive regulation of macromolecule biosynthetic process
GO:0031328	0.872	positive regulation of cellular biosynthetic process
GO:0010468	0.796	regulation of gene expression
GO:0050896	0.738	response to stimulus
GO:0048523	0.723	negative regulation of cellular process
GO:0065009	0.665	regulation of molecular function
GO:0051716	0.664	cellular response to stimulus
GO:0048583	0.662	regulation of response to stimulus
GO:0032501	0.654	multicellular organismal process
GO:0051128	0.630	regulation of cellular component organization
GO:0051252	0.535	regulation of RNA metabolic process
GO:2001141	0.533	regulation of RNA biosynthetic process
GO:0010605	0.515	negative regulation of macromolecule metabolic process
GO:0006950	0.499	response to stress
GO:0044093	0.480	positive regulation of molecular function
GO:0006355	0.476	regulation of DNA-templated transcription
GO:0050790	0.448	regulation of catalytic activity
GO:0010941	0.439	regulation of cell death
GO:0006357	0.411	regulation of transcription by RNA polymerase II
GO:0008152	0.381	metabolic process
GO:0051246	0.365	regulation of protein metabolic process
GO:0032502	0.359	developmental process
GO:0045893	0.353	positive regulation of DNA-templated transcription
GO:0051239	0.347	regulation of multicellular organismal process
GO:0023052	0.337	signaling
GO:0009966	0.326	regulation of signal transduction
GO:1901987	0.312	regulation of cell cycle phase transition
GO:0071704	0.311	organic substance metabolic process
GO:0019220	0.307	regulation of phosphate metabolic process
GO:0042221	0.306	response to chemical
GO:0048856	0.300	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.993	cytosol
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005856	0.958	cytoskeleton
GO:0015630	0.939	microtubule cytoskeleton
GO:0005815	0.745	microtubule organizing center
GO:0005813	0.684	centrosome
GO:0005730	0.623	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]