StarFunc result for job id Q9H4Z2

User Input

>input (1342 residues)
MEENEVESSSDAAPGPGRPEEPSESGLGVGTSEAVSADSSDAAAAPGQAEADDSGVGQSS
DRGSRSQEEVSESSSSADPLPNSYLPDSSSVSHGPVAGVTGGPPALVHSSALPDPNMLVS
DCTASSSDLGSAIDKIIESTIGPDLIQNCITVTSAEDGGAETTRYLILQGPDDGAPMTSP
MSSSTLAHSLAAIEALADGPTSTSTCLEAQGGPSSPVQLPPASGAEEPDLQSLEAMMEVV
VVQQFKCKMCQYRSSTKATLLRHMRERHFRPVAAAAAAAGKKGRLRKWSTSTKSQEEEGP
EEEDDDDIVDAGAIDDLEEDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRKLPRL
EISDLPDGVEGEPLVSSQSGQSPPEPQDPEAPSSSGPGHLVAMGKVSRTPVEAGVSQSDA
ENAAPSCPDEHDTLPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPFLCRICGSRFLSHEDL
RFHVNSHEAGDPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYRKDVIR
HAAVHSRDRKKRPDPTPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCGKSFK
KRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCPYRTFR
EDFLLSHVAVKHTGAKPFACEYCHFSTRHKKNLRLHVRCRHASSFEEWGRRHPEEPPSRR
RPFFSLQQIEELKQQHSAAPGPPPSSPGPPEIPPEATTFQSSEAPSLLCSDTLGGATIIY
QQGAEESTAMATQTALDLLLNMSAQRELGGTALQVAVVKSEDVEAGLASPGGQPSPEGAT
PQVVTLHVAEPGGGAAAESQLGPPDLPQITLAPGPFGGTGYSVITAPPMEEGTSAPGTPY
SEEPAGEAAQAVVVSDTLKEAGTHYIMATDGTQLHHIELTADGSISFPSPDALASGAKWP
LLQCGGLPRDGPEPPSPAKTHCVGDSQSSASSPPATSKALGLAVPPSPPSAATAASKKFS
CKICAEAFPGRAEMESHKRAHAGPGAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCSQC
SFASKNKKDLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLHSPDGRKSGTPTARA
PTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQTVTNQEEA
AYIQEITTADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPEGHHIQVQEGQITHI
QYEQGAPFLQESQIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFGTDETV
PEHIQQLQHQGIEYDVITLADD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A5K6	0.488	0.489	0.000	1337	0.871	0.874	A2A5K6.pdb.gz	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
2	AFDB:Q9H4Z2	1.000	1.000	0.000	1342	1.000	1.000	Q9H4Z2.pdb.gz	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
3	AFDB:B0LVF0	0.062	0.066	3.797E-13	1219	0.149	0.164	B0LVF0.pdb.gz	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
4	AFDB:B8A5T9	0.114	0.150	5.449E-13	927	0.126	0.182	B8A5T9.pdb.gz
5	AFDB:Q90ZW5	0.054	0.056	1.427E-12	1261	0.163	0.174	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
6	AFDB:Q9H582	0.053	0.053	2.048E-12	1327	0.153	0.154	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
7	AFDB:Q9R0G7	0.058	0.061	4.152E-11	1215	0.139	0.154	Q9R0G7.pdb.gz	ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus OX=10090 GN=Zeb2 PE=1 SV=2
8	AFDB:Q8N1G0	0.070	0.074	3.025E-10	1237	0.165	0.179	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
9	AFDB:Q92610	0.058	0.061	1.447E-9	1267	0.115	0.122	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
10	AFDB:A0A2R8QDL5	0.064	0.070	2.979E-9	1191	0.139	0.156	A0A2R8QDL5.pdb.gz
11	PDB:3w5kB	0.048	0.318	1.240E-3	110	0.022	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7vdvX	0.025	0.075	8.245E-1	252	0.028	0.151	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
13	PDB:4kblA	0.033	0.070	9.300E-1	395	0.028	0.096	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:4z4kA	0.028	0.103	9.877E-1	282	0.010	0.050	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
15	PDB:6o9lQ	0.034	0.073	9.877E-1	430	0.037	0.114	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:7o4iW	0.027	0.066	1.257	312	0.025	0.106	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:6mp4E	0.022	0.147	1.334	137	0.013	0.131	6mp4E.pdb.gz	Liver fatty acid-binding protein regulates THC metabolism by facilitating intracellular hepatic transport
18	PDB:2p9eA	0.019	0.056	1.417	406	0.004	0.012	2p9eA.pdb.gz	The Effect of Hinge Mutations on Effector Binding and Domain Rotation in Escherichia coli D-3-Phosphoglycerate Dehydrogenase
19	PDB:1q14A	0.022	0.072	1.803	289	0.010	0.048	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
20	PDB:1sc6D	0.032	0.097	1.915	384	0.007	0.023	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A5K6	0.0	2160	1337	0.865	0.868	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
2	G3V893	0.0	2202	1336	0.872	0.876	ZN335_RAT Zinc finger protein 335 OS=Rattus norvegicus OX=10116 GN=Znf335 PE=1 SV=1
3	Q9H4Z2	0.0	2753	1342	1.000	1.000	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
4	O61360	5.59e-30	131	962	0.061	0.085	O61360_DROME CROL ALPHA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
5	Q923T4	7.51e-30	127	484	0.050	0.138	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
6	Q15072	8.04e-30	123	292	0.051	0.233	OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens OX=9606 GN=ZNF146 PE=1 SV=2
7	O61361	8.81e-30	130	891	0.061	0.092	O61361_DROME CROL BETA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
8	Q08705	1.47e-29	129	728	0.063	0.117	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
9	P58317	2.33e-29	124	390	0.054	0.187	ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens OX=9606 GN=ZNF121 PE=1 SV=2
10	Q9R1D1	3.23e-29	128	737	0.063	0.115	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
11	P17141	1.22e-28	125	594	0.054	0.123	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
12	M9PD94	1.92e-28	126	907	0.060	0.088	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
13	M9PCY3	2.41e-28	125	878	0.058	0.089	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
14	Q8NI51	5.46e-28	124	663	0.062	0.125	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
15	Q8MRK4	8.25e-28	124	878	0.056	0.085	Q8MRK4_DROME Crooked legs, isoform D OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
16	Q3ZCT1	1.07e-27	119	412	0.051	0.165	ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens OX=9606 GN=ZNF260 PE=1 SV=3
17	Q9UK13	1.29e-27	122	617	0.061	0.133	ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens OX=9606 GN=ZNF221 PE=1 SV=4
18	Q8K2Z5	1.34e-27	119	386	0.053	0.184	Q8K2Z5_MOUSE BC029127 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp950 PE=2 SV=1
19	P10074	2.30e-27	122	688	0.063	0.124	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
20	Q14C61	2.48e-27	121	627	0.068	0.145	Q14C61_HUMAN ZNF264 protein OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	6.6e+02	11.7	Adenylate kinase, active site lid
2	PF00428 Ribosomal_60s	2.3e+02	13.8	60s Acidic ribosomal protein
3	PF00096 zf-C2H2	5.4e-21	84.9	Zinc finger, C2H2 type
4	PF12756 zf-C2H2_2	3.4e+02	13.0	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	4.4e-22	87.9	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.059	24.7	C2H2-type zinc finger
7	PF13465 zf-H2C2_2	2.4e-19	80.0	Zinc-finger double domain
8	PF13909 zf-H2C2_5	1.1e-28	109.8	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377024	0.803	CCR4-NOT transcription complex subunit 6
2	9606.ENSP00000417573	0.768	Protein YIPF6
3	9606.ENSP00000416534	0.700	Probable ATP-dependent RNA helicase DDX46
4	9606.ENSP00000384792	0.690	WD repeat-containing protein 62
5	9606.ENSP00000363929	0.674	Nuclear receptor coactivator 6
6	9606.ENSP00000257287	0.667	Centrosomal protein of 135 kDa
7	9606.ENSP00000361486	0.662	Phosphorylated CTD-interacting factor 1
8	9606.ENSP00000440674	0.648	Polyhomeotic-like protein 1
9	9606.ENSP00000342924	0.639	Microcephalin
10	9606.ENSP00000350686	0.636	Ankyrin repeat and LEM domain-containing protein 2
11	9606.ENSP00000335463	0.620	Kinetochore scaffold 1
12	9606.ENSP00000371308	0.618	Centromere protein J
13	9606.ENSP00000360944	0.616	SCL-interrupting locus protein
14	9606.ENSP00000343818	0.614	CDK5 regulatory subunit-associated protein 2
15	9606.ENSP00000356379	0.612	Abnormal spindle-like microcephaly-associated protein
16	9606.ENSP00000370337	0.607	Centrosomal protein of 152 kDa
17	9606.ENSP00000264637	0.555	Thyroid hormone receptor alpha
18	9606.ENSP00000262519	0.550	Histone-lysine N-methyltransferase SETD1A
19	9606.ENSP00000219746	0.537	TOX high mobility group box family member 3
20	9606.ENSP00000377446	0.520	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.875	nucleic acid binding
GO:0003677	0.663	DNA binding
GO:0043565	0.468	sequence-specific DNA binding
GO:0140110	0.444	transcription regulator activity
GO:0003690	0.407	double-stranded DNA binding
GO:0001067	0.406	transcription regulatory region nucleic acid binding
GO:1990837	0.403	sequence-specific double-stranded DNA binding
GO:0000977	0.386	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048522	0.946	positive regulation of cellular process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0010468	0.930	regulation of gene expression
GO:0048856	0.879	anatomical structure development
GO:0032501	0.804	multicellular organismal process
GO:0016043	0.798	cellular component organization
GO:0051239	0.671	regulation of multicellular organismal process
GO:0050793	0.510	regulation of developmental process
GO:0031323	0.490	regulation of cellular metabolic process
GO:0045595	0.473	regulation of cell differentiation
GO:2000026	0.465	regulation of multicellular organismal development
GO:0051171	0.412	regulation of nitrogen compound metabolic process
GO:0080090	0.402	regulation of primary metabolic process
GO:0007275	0.398	multicellular organism development
GO:0009889	0.367	regulation of biosynthetic process
GO:0031326	0.364	regulation of cellular biosynthetic process
GO:0060284	0.340	regulation of cell development
GO:0009893	0.339	positive regulation of metabolic process
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0051252	0.317	regulation of RNA metabolic process
GO:0048519	0.306	negative regulation of biological process
GO:0008152	0.305	metabolic process
GO:0048523	0.302	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:1902494	0.960	catalytic complex
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0140513	0.915	nuclear protein-containing complex
GO:1990234	0.863	transferase complex
GO:0034708	0.781	methyltransferase complex
GO:0035097	0.769	histone methyltransferase complex
GO:0005737	0.741	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]