StarFunc result for job id Q9H4Z3

User Input

>input (704 residues)
MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRP
YYFNRFTNQSLWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENKPRKRQLSEEQP
SGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDI
QTNAVIKHRGPSEVLPPHPEVELLRSQLILKLRQHYRELCQQREGIEPPRESFNRWMLER
KVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKFREEAKRLLFKYAEAARRLIE
SRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVSAAAKDSVEGI
CSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFG
VGLYEGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPC
LDFAPLSGSFEANPPFCEELMDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRME
QSRFKRHQLILPAFEHEYRSGSQHICKKEEMHYKAVHNTAVLFLQNDPGFAKWAPTPERL
QELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSREPHPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59114	0.779	0.777	0.000	706	0.953	0.950	P59114.pdb.gz	CAPAM_MOUSE mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Mus musculus OX=10090 GN=Pcif1 PE=1 SV=1
2	AFDB:A0A0R4IKJ1	0.755	0.738	4.890E-94	721	0.670	0.655	A0A0R4IKJ1.pdb.gz	CAPAM_DANRE mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Danio rerio OX=7955 GN=pcif1 PE=1 SV=1
3	AFDB:Q960B9	0.693	0.533	1.893E-69	920	0.433	0.332	Q960B9.pdb.gz	Q960B9_DROME SD08128p OS=Drosophila melanogaster OX=7227 GN=Pcif1 PE=2 SV=1
4	AFDB:A0A2R8RYT7	0.067	0.068	1.405E-2	693	0.104	0.105	A0A2R8RYT7.pdb.gz
5	AFDB:Q8IRI5	0.069	0.062	1.405E-2	804	0.087	0.076	Q8IRI5.pdb.gz	Q8IRI5_DROME Trio, isoform D OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
6	AFDB:Q5SX79	0.053	0.048	1.563E-2	823	0.115	0.098	Q5SX79.pdb.gz	SHRM1_MOUSE Protein Shroom1 OS=Mus musculus OX=10090 GN=Shroom1 PE=1 SV=2
7	AFDB:P98174	0.064	0.056	2.040E-2	961	0.169	0.124	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
8	AFDB:Q9VVI3	0.062	0.048	2.152E-2	1007	0.047	0.033	Q9VVI3.pdb.gz	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
9	AFDB:Q8H136	0.059	0.065	8.594E-2	619	0.068	0.078	Q8H136.pdb.gz	RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana OX=3702 GN=RH14 PE=1 SV=2
10	AFDB:A4IJ58	0.068	0.060	9.560E-2	831	0.067	0.057	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
11	PDB:6q56A	0.133	0.309	9.780E-2	234	0.020	0.060	6q56A.pdb.gz
12	PDB:7yqcA	0.071	0.208	9.780E-2	198	0.047	0.167	7yqcA.pdb.gz
13	PDB:1yw5A	0.043	0.165	1.088E-1	177	0.018	0.073	1yw5A.pdb.gz
14	PDB:4lecA	0.126	0.334	1.346E-1	202	0.031	0.109	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
15	PDB:2i62B	0.111	0.250	1.498E-1	261	0.031	0.084	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
16	PDB:7kkfA	0.046	0.190	1.666E-1	162	0.018	0.080	7kkfA.pdb.gz
17	PDB:2pjdA	0.124	0.223	1.757E-1	334	0.036	0.075	2pjdA.pdb.gz
18	PDB:7bggA	0.142	0.373	1.853E-1	216	0.024	0.079	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
19	PDB:4hh4C	0.094	0.212	2.293E-1	256	0.030	0.082	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
20	PDB:3crlB	0.115	0.178	2.419E-1	383	0.068	0.125	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IKJ1	0.0	993	721	0.680	0.664	CAPAM_DANRE mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Danio rerio OX=7955 GN=pcif1 PE=1 SV=1
2	P59114	0.0	1368	706	0.952	0.949	CAPAM_MOUSE mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Mus musculus OX=10090 GN=Pcif1 PE=1 SV=1
3	Q960B9	0.0	577	920	0.415	0.317	Q960B9_DROME SD08128p OS=Drosophila melanogaster OX=7227 GN=Pcif1 PE=2 SV=1
4	Q9H4Z3	0.0	1451	704	1.000	1.000	CAPAM_HUMAN mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1
5	Q9VPB7	0.0	578	920	0.415	0.317	Q9VPB7_DROME FI17508p1 OS=Drosophila melanogaster OX=7227 GN=Pcif1 PE=1 SV=1
6	Q95T03	1.25e-07	55.5	243	0.031	0.091	Q95T03_DROME LD30158p OS=Drosophila melanogaster OX=7227 GN=Pcif1 PE=2 SV=1
7	Q9I9K6	1.51e-04	45.1	159	0.030	0.132	Q9I9K6_XENLA Peptidyl-prolyl cis-trans isomerase OS=Xenopus laevis OX=8355 GN=pin1.L PE=1 SV=1
8	B0BNL2	0.003	41.6	165	0.027	0.115	B0BNL2_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=2 SV=1
9	Q6PBX1	0.003	41.6	159	0.028	0.126	Q6PBX1_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:73206 PE=1 SV=1
10	K7EMU7	0.006	40.0	145	0.027	0.131	K7EMU7_HUMAN Peptidyl-prolyl cis-trans isomerase OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1
11	Q13526	0.006	40.4	163	0.027	0.117	PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1
12	Q3ULQ2	0.007	40.0	159	0.026	0.113	Q3ULQ2_MOUSE Peptidyl-prolyl cis-trans isomerase OS=Mus musculus OX=10090 GN=Pin1rt1 PE=1 SV=1
13	Q9QUR7	0.007	40.0	165	0.027	0.115	PIN1_MOUSE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Mus musculus OX=10090 GN=Pin1 PE=1 SV=1
14	A0A8I6GJ67	0.023	38.9	183	0.027	0.104	A0A8I6GJ67_RAT Peptidylprolyl cis/trans isomerase, NIMA-interacting 1 OS=Rattus norvegicus OX=10116 GN=Pin1 PE=1 SV=1
15	P27420	0.036	39.7	661	0.047	0.050	HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans OX=6239 GN=hsp-3 PE=1 SV=2
16	Q57YM3	0.061	38.9	572	0.041	0.051	Q57YM3_TRYB2 PCIF1 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.500 PE=4 SV=1
17	Q9FSY7	0.068	38.9	668	0.028	0.030	BIP_CORAV Endoplasmic reticulum chaperone BiP OS=Corylus avellana OX=13451 PE=1 SV=1
18	Q557E0	0.18	37.7	632	0.031	0.035	HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum OX=44689 GN=hspE-1 PE=1 SV=1
19	Q38924	0.22	37.0	469	0.027	0.041	PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12 OS=Arabidopsis thaliana OX=3702 GN=PAP12 PE=2 SV=3
20	B9RYP6	0.30	37.0	664	0.028	0.030	B9RYP6_RICCO Heat shock protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1312280 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12237 PCIF1_WW	1.9e-69	244.3	Phosphorylated CTD interacting factor 1 WW domain
2	PF00397 WW	3.2e-07	41.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361486

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370421	0.777	Pancreas/duodenum homeobox protein 1
2	9606.ENSP00000317445	0.687	Proactivator polypeptide-like 1
3	9606.ENSP00000325326	0.662	Zinc finger protein 335
4	9606.ENSP00000334040	0.637	Round spermatid basic protein 1 like
5	9606.ENSP00000369636	0.589	PX domain containing 1
6	9606.ENSP00000262109	0.587	Glutamate-rich protein 1
7	9606.ENSP00000369989	0.566	Katanin p60 ATPase-containing subunit A-like 1
8	9606.ENSP00000480158	0.562	DNA-directed RNA polymerase II subunit RPB1
9	9606.ENSP00000355924	0.530	N-lysine methyltransferase SMYD2
10	9606.ENSP00000300651	0.526	Mediator of RNA polymerase II transcription subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1904047	1.000	S-adenosyl-L-methionine binding
GO:0008174	1.000	mRNA methyltransferase activity
GO:0050815	0.999	phosphoserine residue binding
GO:0000993	0.999	RNA polymerase II complex binding
GO:0016422	0.994	mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0016556	0.994	mRNA modification
GO:0001510	0.987	RNA methylation
GO:0050789	0.908	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0019222	0.720	regulation of metabolic process
GO:0060255	0.565	regulation of macromolecule metabolic process
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0048518	0.480	positive regulation of biological process
GO:0048522	0.459	positive regulation of cellular process
GO:0010468	0.457	regulation of gene expression
GO:0031323	0.440	regulation of cellular metabolic process
GO:0080090	0.429	regulation of primary metabolic process
GO:0048519	0.401	negative regulation of biological process
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0051173	0.398	positive regulation of nitrogen compound metabolic process
GO:0048523	0.377	negative regulation of cellular process
GO:0031325	0.372	positive regulation of cellular metabolic process
GO:0010556	0.303	regulation of macromolecule biosynthetic process
GO:0031326	0.303	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0015630	0.987	microtubule cytoskeleton
GO:0045171	0.975	intercellular bridge
GO:0005737	0.591	cytoplasm
GO:0032991	0.339	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:22744	0.994	a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-(2'-O-methyladenosine) in mRNA + S-adenosyl-L-methionine = a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-(N(6),2'-O-dimethyladenosine) in mRNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.62	0.994	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase.

[back to server]