StarFunc result for job id Q9H511

User Input

>input (634 residues)
MAPKKKIVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLL
EGLSKMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSIQRVDLNDISPLG
LATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYVVNIAE
TYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQKRTHFSLSVFNGL
VYAAGGRNAEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVADGRVLVTGGYIANAYS
RSVCAYDPASDSWQELPNLSTPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSP
ATGQWSYAAPLQVGVSTAGVSALHGRAYLVGGWNEGEKKYKKCIQCFSPELNEWTEDDEL
PEATVGVSCCTLSMPNNVTRESRASSVSSVPVSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BWA5	0.958	0.958	0.000	634	0.920	0.920	Q8BWA5.pdb.gz	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
2	AFDB:Q9P2N7	0.770	0.748	4.361E-67	655	0.322	0.311	Q9P2N7.pdb.gz	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
3	AFDB:Q53HC5	0.732	0.752	1.394E-64	615	0.320	0.330	Q53HC5.pdb.gz	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
4	AFDB:Q8N4N3	0.808	0.830	4.253E-63	616	0.293	0.302	Q8N4N3.pdb.gz	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
5	AFDB:Q69ZK5	0.615	0.619	1.054E-62	630	0.330	0.332	Q69ZK5.pdb.gz	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
6	AFDB:Q96NJ5	0.811	0.829	7.031E-58	620	0.279	0.285	Q96NJ5.pdb.gz	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
7	AFDB:Q9Y2M5	0.456	0.473	8.650E-57	609	0.254	0.264	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
8	AFDB:Q9VUU5	0.491	0.499	9.625E-57	623	0.254	0.258	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
9	AFDB:Q53GT1	0.744	0.744	1.192E-56	634	0.257	0.257	Q53GT1.pdb.gz	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
10	AFDB:Q6TDP4	0.554	0.549	1.064E-55	642	0.263	0.260	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
11	PDB:2uvkB	0.380	0.664	5.875E-17	349	0.088	0.160	2uvkB.pdb.gz
12	PDB:5gqtA	0.349	0.464	7.275E-17	470	0.085	0.115	5gqtA.pdb.gz
13	PDB:5gq0A	0.347	0.630	1.241E-16	338	0.084	0.157	5gq0A.pdb.gz
14	PDB:2zwaB	0.333	0.311	3.714E-12	683	0.062	0.057	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6ttuT	0.279	0.419	1.119E-8	394	0.068	0.109	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
16	PDB:6dbjD	0.291	0.479	2.363E-8	352	0.073	0.131	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
17	PDB:2hqsA	0.334	0.486	3.622E-8	412	0.049	0.075	2hqsA.pdb.gz
18	PDB:6oemB	0.294	0.498	4.731E-8	346	0.065	0.118	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
19	PDB:7mq8LR	0.230	0.195	1.112E-7	773	0.055	0.045	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3sfzA	0.287	0.173	2.226E-7	1133	0.095	0.053	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BWA5	0.0	1197	634	0.896	0.896	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
2	Q9H511	0.0	1326	634	1.000	1.000	KLH31_HUMAN Kelch-like protein 31 OS=Homo sapiens OX=9606 GN=KLHL31 PE=2 SV=1
3	Q9P2J3	4.18e-128	392	617	0.341	0.350	KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens OX=9606 GN=KLHL9 PE=1 SV=2
4	Q9P2N7	4.51e-126	388	655	0.331	0.321	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
5	Q53HC5	6.12e-123	379	615	0.325	0.335	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
6	Q9P2G3	6.19e-105	333	628	0.306	0.309	KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens OX=9606 GN=KLHL14 PE=1 SV=2
7	Q69ZK5	1.22e-104	332	630	0.304	0.306	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
8	Q8N4N3	4.55e-98	314	616	0.293	0.302	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
9	Q96NJ5	1.32e-80	268	620	0.282	0.289	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
10	Q53GT1	8.47e-77	259	634	0.263	0.263	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
11	Q8K430	2.30e-73	249	640	0.251	0.248	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
12	Q99JN2	2.39e-73	249	634	0.246	0.246	KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus OX=10090 GN=Klhl22 PE=1 SV=1
13	Q6TDP4	5.89e-73	249	642	0.248	0.245	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
14	Q96M94	8.60e-72	244	604	0.238	0.250	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
15	Q9Y2M5	2.90e-71	243	609	0.248	0.258	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
16	E9Q4F2	2.69e-70	240	574	0.263	0.291	KLH18_MOUSE Kelch-like protein 18 OS=Mus musculus OX=10090 GN=Klhl18 PE=1 SV=1
17	O94889	1.20e-69	238	574	0.262	0.289	KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=KLHL18 PE=1 SV=3
18	Q9UH77	2.10e-68	235	587	0.233	0.252	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
19	E0CZ16	8.39e-68	233	587	0.235	0.254	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
20	Q96PQ7	5.32e-67	235	755	0.248	0.208	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	2.9e-23	93.2	BTB And C-terminal Kelch
2	PF00651 BTB	1.1e-17	75.6	BTB/POZ domain
3	PF07893 DUF1668	0.043	24.8	Protein of unknown function (DUF1668)
4	PF07250 Glyoxal_oxid_N	1	20.1	Glyoxal oxidase N-terminus
5	PF01344 Kelch_1	1.3e-39	144.9	Kelch motif
6	PF07646 Kelch_2	2.4e-14	63.9	Kelch motif
7	PF13415 Kelch_3	6.4e-18	75.9	Galactose oxidase, central domain
8	PF13418 Kelch_4	2.6e-15	67.4	Galactose oxidase, central domain
9	PF13854 Kelch_5	3.1e-09	47.7	Kelch motif
10	PF13964 Kelch_6	2.7e-35	130.7	Kelch motif
11	PF13570 PQQ_3	5.4	18.9	PQQ-like domain
12	PF03089 RAG2	81	13.6	Recombination activating protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483489	0.829	N-terminal Xaa-Pro-Lys N-methyltransferase 1
2	9606.ENSP00000335651	0.794	Fibronectin type III and SPRY domain containing 2
3	9606.ENSP00000264414	0.783	Cullin-3
4	9606.ENSP00000389103	0.768	60S ribosomal protein L23a
5	9606.ENSP00000259782	0.706	Tubulointerstitial nephritis antigen
6	9606.ENSP00000467141	0.699	Titin
7	9606.ENSP00000304078	0.690	Protein FAM83B
8	9606.ENSP00000481127	0.685	Proline dehydrogenase 1, mitochondrial
9	9606.ENSP00000268876	0.661	Protein unc-45 homolog B
10	9606.ENSP00000386389	0.659	Kelch-like protein 30
11	9606.ENSP00000368808	0.657	Small muscular protein
12	9606.ENSP00000352282	0.648	Kelch domain containing 1
13	9606.ENSP00000393453	0.645	Histone-lysine N-methyltransferase SMYD1
14	9606.ENSP00000394770	0.637	Cardiomyopathy-associated protein 5
15	9606.ENSP00000419199	0.637	Ankyrin repeat and SOCS box protein 14
16	9606.ENSP00000303394	0.635	Heat shock protein beta-3
17	9606.ENSP00000287777	0.634	Kelch-like protein 40
18	9606.ENSP00000238788	0.624	Transmembrane protein 214
19	9606.ENSP00000359925	0.621	Leucine-rich repeat-containing protein 1
20	9606.ENSP00000351767	0.620	Collagen alpha-1(XX) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0070302	0.862	regulation of stress-activated protein kinase signaling cascade
GO:1902532	0.855	negative regulation of intracellular signal transduction
GO:0031400	0.854	negative regulation of protein modification process
GO:0051174	0.842	regulation of phosphorus metabolic process
GO:0043409	0.826	negative regulation of MAPK cascade
GO:0042326	0.820	negative regulation of phosphorylation
GO:0046328	0.796	regulation of JNK cascade
GO:0032873	0.793	negative regulation of stress-activated MAPK cascade
GO:0001933	0.786	negative regulation of protein phosphorylation
GO:0009987	0.773	cellular process
GO:0046329	0.768	negative regulation of JNK cascade
GO:0071704	0.475	organic substance metabolic process
GO:0044238	0.474	primary metabolic process
GO:0006807	0.461	nitrogen compound metabolic process
GO:1901564	0.408	organonitrogen compound metabolic process
GO:0043170	0.405	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus
GO:0070013	0.680	intracellular organelle lumen
GO:0005829	0.673	cytosol
GO:0031981	0.459	nuclear lumen
GO:0043228	0.409	non-membrane-bounded organelle
GO:0043232	0.399	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]