StarFunc result for job id Q9H553

User Input

>input (416 residues)
MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCF
AESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSAC
IPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFT
AAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNL
TLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFL
RSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGF
LCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H553	1.000	1.000	8.105E-78	416	1.000	1.000	Q9H553.pdb.gz	ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
2	AFDB:F1QPS1	0.965	0.883	2.086E-58	455	0.651	0.596	F1QPS1.pdb.gz	F1QPS1_DANRE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Danio rerio OX=7955 GN=im:7145131 PE=1 SV=1
3	AFDB:Q95SA2	0.928	0.911	5.379E-47	424	0.502	0.493	Q95SA2.pdb.gz	Q95SA2_DROME Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Drosophila melanogaster OX=7227 GN=Alg2 PE=2 SV=1
4	AFDB:Q7KWM5	0.898	0.890	1.502E-41	420	0.450	0.445	Q7KWM5.pdb.gz	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
5	AFDB:P43636	0.870	0.726	1.098E-37	503	0.397	0.328	P43636.pdb.gz	ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG2 PE=1 SV=2
6	AFDB:Q96WW6	0.914	0.756	1.352E-37	506	0.385	0.316	Q96WW6.pdb.gz	ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg2 PE=3 SV=2
7	AFDB:Q6FJJ9	0.865	0.789	7.052E-36	458	0.404	0.367	Q6FJJ9.pdb.gz	ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ALG2 PE=3 SV=1
8	AFDB:Q38E70	0.710	0.638	2.043E-21	470	0.224	0.198	Q38E70.pdb.gz	Q38E70_TRYB2 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0860 PE=3 SV=1
9	AFDB:Q9XEE9	0.757	0.687	2.515E-21	463	0.207	0.186	Q9XEE9.pdb.gz	ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG11 PE=1 SV=2
10	AFDB:Q54DM9	0.741	0.624	3.057E-20	505	0.209	0.172	Q54DM9.pdb.gz	ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg11 PE=3 SV=1
11	PDB:3s27H	0.656	0.378	1.030E-16	797	0.195	0.102	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
12	PDB:3guhA	0.676	0.600	4.087E-14	477	0.161	0.140	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
13	PDB:3okaA	0.681	0.744	8.467E-14	378	0.192	0.212	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
14	PDB:4pqgA	0.601	0.509	1.643E-12	506	0.154	0.126	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
15	PDB:2iv7A	0.639	0.706	6.357E-12	370	0.166	0.186	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
16	PDB:5hvoA	0.661	0.606	1.708E-11	459	0.139	0.126	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
17	PDB:5hutA	0.676	0.609	2.875E-11	469	0.166	0.147	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
18	PDB:7q0bB	0.618	0.438	3.028E-11	623	0.204	0.136	7q0bB.pdb.gz
19	PDB:2wtxD	0.636	0.587	5.956E-11	457	0.144	0.131	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
20	PDB:3d0rB	0.449	0.479	6.609E-11	381	0.154	0.168	3d0rB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QPS1	0.0	567	455	0.656	0.600	F1QPS1_DANRE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Danio rerio OX=7955 GN=im:7145131 PE=1 SV=1
2	Q9H553	0.0	858	416	1.000	1.000	ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
3	Q9VZU8	1.23e-139	407	424	0.507	0.498	Q9VZU8_DROME Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Drosophila melanogaster OX=7227 GN=Alg2 PE=1 SV=1
4	Q95SA2	2.90e-139	406	424	0.505	0.495	Q95SA2_DROME Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Drosophila melanogaster OX=7227 GN=Alg2 PE=2 SV=1
5	Q7KWM5	5.57e-121	359	420	0.462	0.457	ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1
6	P43636	4.62e-91	285	503	0.411	0.340	ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG2 PE=1 SV=2
7	Q96WW6	3.88e-89	281	506	0.401	0.330	ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg2 PE=3 SV=2
8	Q6FJJ9	2.17e-86	272	458	0.416	0.378	ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ALG2 PE=3 SV=1
9	Q54DM9	1.93e-12	70.9	505	0.156	0.129	ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg11 PE=3 SV=1
10	Q2TAA5	6.88e-11	66.2	492	0.168	0.142	ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
11	Q9LXL5	2.44e-10	64.7	808	0.137	0.071	SUS4_ARATH Sucrose synthase 4 OS=Arabidopsis thaliana OX=3702 GN=SUS4 PE=1 SV=1
12	P31924	3.55e-10	64.3	816	0.154	0.078	SUS1_ORYSJ Sucrose synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SUS1 PE=1 SV=1
13	G1JRK6	4.78e-10	63.9	796	0.130	0.068	G1JRK6_GOSHI Sucrose synthase OS=Gossypium hirsutum OX=3635 PE=2 SV=1
14	Q9XGB7	7.65e-10	63.2	806	0.154	0.079	Q9XGB7_GOSHI Sucrose synthase OS=Gossypium hirsutum OX=3635 PE=2 SV=1
15	P49040	2.25e-09	62.0	808	0.135	0.069	SUS1_ARATH Sucrose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SUS1 PE=1 SV=3
16	P04712	2.39e-08	58.5	802	0.147	0.076	SUS1_MAIZE Sucrose synthase 1 OS=Zea mays OX=4577 GN=SH-1 PE=2 SV=1
17	Q00917	2.48e-08	58.5	807	0.132	0.068	SUS2_ARATH Sucrose synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SUS2 PE=2 SV=3
18	P9WMZ3	2.51e-08	57.8	385	0.137	0.148	PIMB_MYCTU GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimB PE=1 SV=1
19	A0R043	2.70e-08	57.8	382	0.135	0.147	PIMB_MYCS2 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimB PE=1 SV=1
20	P30298	7.10e-07	53.9	808	0.149	0.077	SUS2_ORYSJ Sucrose synthase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SUS2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00534 Glycos_transf_1	3.9e-32	122.6	Glycosyl transferases group 1
2	PF13439 Glyco_transf_4	4.9e-13	60.9	Glycosyltransferase Family 4
3	PF13524 Glyco_trans_1_2	0.0024	29.6	Glycosyl transferases group 1
4	PF13692 Glyco_trans_1_4	3.6e-13	61.5	Glycosyl transferases group 1
5	PF13579 Glyco_trans_4_4	8.9e-12	57.1	Glycosyl transferase 4-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417764

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262374	0.976	Chitobiosyldiphosphodolichol beta-mannosyltransferase
2	9606.ENSP00000430236	0.943	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
3	9606.ENSP00000268261	0.840	Phosphomannomutase 2
4	9606.ENSP00000411825	0.830	Programmed cell death 6-interacting protein
5	9606.ENSP00000332247	0.821	V-type proton ATPase 116 kDa subunit a isoform 2
6	9606.ENSP00000386597	0.808	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
7	9606.ENSP00000361667	0.774	Dolichol kinase
8	9606.ENSP00000307423	0.753	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
9	9606.ENSP00000359224	0.743	UDP-N-acetylglucosamine transferase subunit ALG14 homolog
10	9606.ENSP00000297135	0.741	Conserved oligomeric Golgi complex subunit 5
11	9606.ENSP00000457718	0.734	Conserved oligomeric Golgi complex subunit 8
12	9606.ENSP00000305459	0.733	Conserved oligomeric Golgi complex subunit 8
13	9606.ENSP00000309953	0.727	EGF containing fibulin extracellular matrix protein 2
14	9606.ENSP00000251968	0.725	Tumor susceptibility gene 101 protein
15	9606.ENSP00000398610	0.701	Annexin A11
16	9606.ENSP00000360645	0.693	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
17	9606.ENSP00000299886	0.691	Conserved oligomeric Golgi complex subunit 1
18	9606.ENSP00000353104	0.689	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
19	9606.ENSP00000262623	0.688	Potassium-transporting ATPase alpha chain 1
20	9606.ENSP00000361625	0.687	Dolichyldiphosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000030	1.000	mannosyltransferase activity
GO:0048306	0.999	calcium-dependent protein binding
GO:0046983	0.999	protein dimerization activity
GO:0046982	0.992	protein heterodimerization activity
GO:0000033	0.311	alpha-1,3-mannosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901137	0.997	carbohydrate derivative biosynthetic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0036211	0.994	protein modification process
GO:0034645	0.987	cellular macromolecule biosynthetic process
GO:0044255	0.986	cellular lipid metabolic process
GO:0006490	0.974	oligosaccharide-lipid intermediate biosynthetic process
GO:0006487	0.958	protein N-linked glycosylation
GO:0042221	0.927	response to chemical
GO:0010035	0.751	response to inorganic substance
GO:0051592	0.561	response to calcium ion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0016020	0.998	membrane
GO:0005634	0.998	nucleus
GO:0031090	0.994	organelle membrane
GO:0031984	0.934	organelle subcompartment
GO:0005783	0.922	endoplasmic reticulum
GO:0005789	0.904	endoplasmic reticulum membrane
GO:0048471	0.385	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]