StarFunc result for job id Q9H582

User Input

>input (1327 residues)
MRSFLQQDVNKTKSRLNVLNGLANNMDDLKINTDITGAKEELLDDNNFISDKESGVHKPK
DCQTSFQKNNTLTLPEELSKDKSENALSGGQSSLFIHAGAPTVSSENFILPKGAAVNGPV
SHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSD
VAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKSDGTLINQVEVGEDGEDLLVKDDCVNT
VTGISSGTDGFRSENDTNWDPQKEFIQFLMTNEETVDKAPPHSKIGLEKKRKRKMDVSKI
TRYTEDCFSDSNCVPNKSKMQEVDFLEQNEELQAVDSQKYALSKVKPESTDEDLESVDAF
QHLIYNPDKCGEESSPVHTSTFLSNTLKKKCEESDSESPATFSTEEPSFYPCTKCNVNFR
EKKHLHRHMMYHLDGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEE
IRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENEL
ECHRGIAHGAVVKCPMVTSDIAQRKTQKKTFMKDSVVGSSKKSATYICKMCPFTTSAKSV
LKKHTEYLHSSSCVDSFGSPLGLDKRKNDILEEPVDSDSTKTLTKQQSTTFPKNSALKQD
VKRTFGSTSQSSSFSKIHKRPHRIQKARKSIAQSGVNMCNQNSSPHKNVTIKSSVDQKPK
YFHQAAKEKSNAKANSHYLYRHKYENYRMIKKSGESYPVHFKKEEASSLNSLHLFSSSSN
SHNNFISDPHKPDAKRPESFKDHRRVAVKRVIKESKKESSVGGEDLDSYPDFLHKMTVVV
LQKLNSAEKKDSYETEDESSWDNVELGDYTTQAIEDETYSDINQEHVNLFPLFKSKVEGQ
EPGENATLSYDQNDGFYFEYYEDTGSNNFLHEIHDPQHLETADASLSKHSSVFHWTDLSL
EKKSCPYCPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGTGT
PVKRVRKAIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLN
EMMQNEEKYEKILKALNSRRIIPRPFVAQKLASSDDFISQNVIPLEAYRNGLKTEALSVS
ASEEEGLNFLNEYDETKPELPSGKKNQSLTLIELLKNKRMGEERNSAISPQKIHNQTARK
RFVQKCVLPLNEDSPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYI
LRCRFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSL
LMAEAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H582	1.000	1.000	0.000	1327	1.000	1.000	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
2	AFDB:A2BIH4	0.085	0.093	3.720E-32	1169	0.243	0.276	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
3	AFDB:A2A5K6	0.058	0.058	1.442E-13	1337	0.153	0.152	A2A5K6.pdb.gz	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
4	AFDB:Q3URU2	0.050	0.045	4.558E-12	1571	0.165	0.139	Q3URU2.pdb.gz	PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus OX=10090 GN=Peg3 PE=1 SV=1
5	AFDB:A0A286Y942	0.059	0.061	8.979E-9	1242	0.121	0.129	A0A286Y942.pdb.gz
6	AFDB:P19538	0.051	0.049	3.279E-8	1397	0.136	0.130	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
7	AFDB:Q9VXJ5	0.047	0.048	7.160E-7	1311	0.118	0.120	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
8	AFDB:E9PYF4	0.037	0.032	1.149E-5	1699	0.142	0.111	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
9	AFDB:Q6FUJ4	0.041	0.043	1.663E-5	1185	0.127	0.143	Q6FUJ4.pdb.gz	Q6FUJ4_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F03003g PE=4 SV=1
10	AFDB:Q90ZW5	0.054	0.056	2.264E-5	1261	0.118	0.125	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
11	PDB:3w5kB	0.031	0.231	1.295E-1	110	0.020	0.236	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.019	0.187	1.953	62	0.008	0.177	6ydhA.pdb.gz
13	PDB:6zheC	0.027	0.047	1.953	705	0.020	0.037	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
14	PDB:6yxyAo	0.039	0.147	2.209	184	0.022	0.158	6yxyAo.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:7p2eG	0.033	0.102	2.499	330	0.020	0.082	7p2eG.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
16	PDB:6ajkA	0.026	0.104	2.658	293	0.003	0.014	6ajkA.pdb.gz	Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
17	PDB:6bk8O	0.037	0.137	2.658	229	0.017	0.100	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:7r7jB	0.015	0.029	3.198	574	0.009	0.021	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
19	PDB:7oqyY	0.021	0.151	3.848	92	0.011	0.152	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
20	PDB:5datC0	0.030	0.206	4.925	96	0.005	0.062	5datC0.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H582	0.0	2770	1327	1.000	1.000	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
2	A2BIH4	1.36e-58	224	1169	0.111	0.126	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
3	A0A669KAV7	6.44e-28	125	1889	0.056	0.039	A0A669KAV7_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
4	O95785	7.18e-28	125	1651	0.056	0.045	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
5	A0A2R8YFV2	7.99e-28	125	1699	0.056	0.044	A0A2R8YFV2_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
6	O88286	9.28e-26	118	1684	0.059	0.046	WIZ_MOUSE Protein Wiz OS=Mus musculus OX=10090 GN=Wiz PE=1 SV=2
7	Q96EQ9	1.05e-09	65.5	843	0.041	0.065	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
8	A0A669KBG4	4.46e-09	63.5	933	0.016	0.023	A0A669KBG4_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
9	B9EGQ5	5.17e-09	63.2	832	0.016	0.025	B9EGQ5_HUMAN WIZ protein OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
10	A0A669KBH9	6.24e-09	63.2	1066	0.016	0.020	A0A669KBH9_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
11	M0QXA7	7.34e-09	62.8	968	0.016	0.022	M0QXA7_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
12	Q6P1L6	3.60e-08	60.5	599	0.042	0.093	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
13	Q9NQV7	6.58e-08	59.7	894	0.040	0.059	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
14	Q3SY52	1.06e-07	58.5	487	0.057	0.156	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
15	Q8TD17	1.42e-07	58.5	642	0.040	0.083	ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens OX=9606 GN=ZNF398 PE=1 SV=1
16	O43309	2.55e-07	57.4	611	0.044	0.095	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
17	A0A0B4LF29	2.56e-07	57.8	665	0.057	0.113	A0A0B4LF29_DROME Combgap, isoform K OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
18	A0A126GUP1	3.25e-07	57.4	686	0.047	0.092	A0A126GUP1_DROME Combgap, isoform N OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
19	Q9H7X3	3.30e-07	56.6	374	0.038	0.134	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
20	Q9H4Z2	3.33e-07	57.8	1342	0.041	0.040	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	0.88	21.3	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	2.1e-13	60.8	C2H2-type zinc finger
3	PF15269 zf-C2H2_7	3e+02	12.9	Zinc-finger
4	PF15909 zf-C2H2_8	4.3e+02	12.7	C2H2-type zinc ribbon
5	PF18387 zf_C2H2_ZHX	2.8e+02	12.7	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364678	0.953	Histone-lysine N-methyltransferase EHMT2
2	9606.ENSP00000316881	0.855	Prolyl 3-hydroxylase 2
3	9606.ENSP00000220166	0.790	Pro-cathepsin H
4	9606.ENSP00000476603	0.752	G protein-regulated inducer of neurite outgrowth 3
5	9606.ENSP00000380718	0.729	Chromodomain Y-like protein
6	9606.ENSP00000266980	0.701	Zinc transporter ZIP5
7	9606.ENSP00000346112	0.691	Solute carrier family 12 member 6
8	9606.ENSP00000281172	0.673	Epidermal growth factor receptor kinase substrate 8
9	9606.ENSP00000353575	0.640	Translation initiation factor eIF-2B subunit gamma
10	9606.ENSP00000263174	0.632	Palmdelphin
11	9606.ENSP00000257177	0.619	Terminal uridylyltransferase 4
12	9606.ENSP00000359454	0.612	Probable ATP-dependent DNA helicase HFM1
13	9606.ENSP00000255108	0.607	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
14	9606.ENSP00000481321	0.603	Gamma-aminobutyric acid receptor subunit rho-3
15	9606.ENSP00000384999	0.602	Prolyl 4-hydroxylase subunit alpha-2
16	9606.ENSP00000310696	0.599	Beta-1,4-galactosyltransferase 2
17	9606.ENSP00000332646	0.595	Major facilitator superfamily domain-containing protein 10
18	9606.ENSP00000263381	0.591	Protein Wiz
19	9606.ENSP00000328352	0.577	BTB/POZ domain-containing protein KCTD11
20	9606.ENSP00000444433	0.561	Protein SCO2 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0001221	0.995	transcription coregulator binding
GO:0000978	0.995	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.993	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001222	0.991	transcription corepressor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0019222	0.955	regulation of metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0019219	0.738	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.628	regulation of gene expression
GO:0032501	0.573	multicellular organismal process
GO:0051252	0.442	regulation of RNA metabolic process
GO:0031326	0.426	regulation of cellular biosynthetic process
GO:0010556	0.425	regulation of macromolecule biosynthetic process
GO:0006355	0.410	regulation of DNA-templated transcription
GO:0032502	0.399	developmental process
GO:0048519	0.399	negative regulation of biological process
GO:0048523	0.347	negative regulation of cellular process
GO:0048856	0.316	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005737	0.638	cytoplasm
GO:0071944	0.397	cell periphery
GO:0005829	0.342	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]