StarFunc result for job id Q9H583

User Input

>input (2144 residues)
MTSLAQQLQRLALPQSDASLLSRDEVASLLFDPKEAATIDRDTAFAIGCTGLEELLGIDP
SFEQFEAPLFSQLAKTLERSVQTKAVNKQLDENISLFLIHLSPYFLLKPAQKCLEWLIHR
FHIHLYNQDSLIACVLPYHETRIFVRVIQLLKINNSKHRWFWLLPVKQSGVPLAKGTLIT
HCYKDLGFMDFICSLVTKSVKVFAEYPGSSAQLRVLLAFYASTIVSALVAAEDVSDNIIA
KLFPYIQKGLKSSLPDYRAATYMIICQISVKVTMENTFVNSLASQIIKTLTKIPSLIKDG
LSCLIVLLQRQKPESLGKKPFPHLCNVPDLITILHGISETYDVSPLLHYMLPHLVVSIIH
HVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSL
LNEQFLPLIRLLESKYPRTLDVVLEEHLKEIADLKKQELFHQFVSLSTSGGKYQFLADSD
TSLMLSLNHPLAPVRILAMNHLKKIMKTSKEGVDESFIKEAVLARLGDDNIDVVLSAISA
FEIFKEHFSSEVTISNLLNLFQRAELSKNGEWYEVLKIAADILIKEEILSENDQLSNQVV
VCLLPFMVINNDDTESAEMKIAIYLSKSGICSLHPLLRGWEEALENVIKSTKPGKLIGVA
NQKMIELLADNINLGDPSSMLKMVEDLISVGEEESFNLKQKVTFHVILSVLVSCCSSLKE
THFPFAIRVFSLLQKKIKKLESVITAVEIPSEWHIELMLDRGIPVELWAHYVEELNSTQR
VAVEDSVFLVFSLKKFIYALKAPKSFPKGDIWWNPEQLKEDSRDYLHLLIGLFEMMLNGA
DAVHFRVLMKLFIKVHLEDVFQLFKFCSVLWTYGSSLSNPLNCSVKTVLQTQALYVGCAM
LSSQKTQCKHQLASISSPVVTSLLINLGSPVKEVRRAAIQCLQALSGVASPFYLIIDHLI
SKAEEITSDAAYVIQDLATLFEELQREKKLKSHQKLSETLKNLLSCVYSCPSYIAKDLMK
VLQGVNGEMVLSQLLPMAEQLLEKIQKEPTAVLKDEAMVLHLTLGKYNEFSVSLLNEDPK
SLDIFIKAVHTTKELYAGMPTIQITALEKITKPFFAAISDEKVQQKLLRMLFDLLVNCKN
SHCAQTVSSVFKGISVNAEQVRIELEPPDKAKPLGTVQQKRRQKMQQKKSQDLESVQEVG
GSYWQRVTLILELLQHKKKLRSPQILVPTLFNLLSRCLEPLPQEQGNMEYTKQLILSCLL
NICQKLSPDGGKIPKDILDEEKFNVELIVQCIRLSEMPQTHHHALLLLGTVAGIFPDKVL
HNIMSIFTFMGANVMRLDDTYSFQVINKTVKMVIPALIQSDSGDSIEVSRNVEEIVVKII
SVFVDALPHVPEHRRLPILVQLVDTLGAEKFLWILLILLFEQYVTKTVLAAAYGEKDAIL
EADTEFWFSVCCEFSVQHQIQSLMNILQYLLKLPEEKEETIPKAVSFNKSESQEEMLQVF
NVETHTSKQLRHFKFLSVSFMSQLLSSNNFLKKVVESGGPEILKGLEERLLETVLGYISA
VAQSMERNADKLTVKFWRALLSKAYDLLDKVNALLPTETFIPVIRGLVGNPLPSVRRKAL
DLLNNKLQQNISWKKTIVTRFLKLVPDLLAIVQRKKKEGEEEQAINRQTALYTLKLLCKN
FGAENPDPFVPVLNTAVKLIAPERKEEKNVLGSALLCIAEVTSTLEALAIPQLPSLMPSL
LTTMKNTSELVSSEVYLLSALAALQKVVETLPHFISPYLEGILSQVIHLEKITSEMGSAS
QANIRLTSLKKTLATTLAPRVLLPAIKKTYKQIEKNWKNHMGPFMSILQEHIGVMKKEEL
TSHQSQLTAFFLEALDFRAQHSENDLEEVGKTENCIIDCLVAMVVKLSEVTFRPLFFKLF
DWAKTEDAPKDRLLTFYNLADCIAEKLKGLFTLFAGHLVKPFADTLNQVNISKTDEAFFD
SENDPEKCCLLLQFILNCLYKIFLFDTQHFISKERAEALMMPLVDQLENRLGGEEKFQER
VTKHLIPCIAQFSVAMADDSLWKPLNYQILLKTRDSSPKVRFAALITVLALAEKLKENYI
VLLPESIPFLAELMEDECEEVEHQCQKTIQQLETVLGEPLQSYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq8LM	0.326	0.346	0.000	2005	0.934	0.999	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	PDB:7mqaLM	0.331	0.346	0.000	2041	0.951	0.999	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:Q7SY48	0.787	0.782	0.000	2159	0.543	0.540	Q7SY48.pdb.gz	HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio OX=7955 GN=heatr1 PE=2 SV=1
4	AFDB:Q9H583	1.000	1.000	0.000	2144	1.000	1.000	Q9H583.pdb.gz	HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3
5	AFDB:Q38FN3	0.256	0.216	1.334E-35	2631	0.170	0.139	Q38FN3.pdb.gz	Q38FN3_TRYB2 HEAT repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1560 PE=3 SV=1
6	AFDB:P42945	0.300	0.352	1.061E-27	1769	0.178	0.216	P42945.pdb.gz	UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP10 PE=1 SV=1
7	PDB:7d4iAE	0.245	0.327	1.132E-22	1552	0.152	0.210	7d4iAE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
8	PDB:7mqaSP	0.149	0.134	3.456E-16	2485	0.136	0.117	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	AFDB:E9PVA8	0.120	0.102	7.120E-16	2671	0.153	0.122	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
10	AFDB:Q10105	0.127	0.112	2.009E-15	2670	0.139	0.112	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
11	AFDB:P33892	0.137	0.120	2.703E-15	2672	0.127	0.102	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
12	PDB:6zqbUJ	0.170	0.314	3.312E-15	1117	0.127	0.244	6zqbUJ.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
13	AFDB:F4I718	0.143	0.144	3.375E-15	2136	0.135	0.136	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
14	AFDB:B3CJ34	0.148	0.132	6.824E-15	2634	0.141	0.115	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
15	AFDB:F4I893	0.098	0.083	1.380E-14	2696	0.160	0.127	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
16	PDB:7sicA	0.099	0.085	4.200E-11	2773	0.137	0.106	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
17	PDB:7tyrA	0.117	0.083	4.359E-11	3905	0.143	0.079	7tyrA.pdb.gz
18	PDB:7sglA	0.132	0.096	5.649E-11	3852	0.138	0.077	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
19	PDB:7otmA	0.162	0.111	7.056E-11	3656	0.122	0.071	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
20	PDB:7ajuUT	0.153	0.148	7.322E-11	2313	0.138	0.128	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T3Q7	0.0	3806	2063	0.894	0.929	Q5T3Q7_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=1
2	Q7SY48	0.0	2243	2159	0.547	0.543	HEAT1_DANRE HEAT repeat-containing protein 1 OS=Danio rerio OX=7955 GN=heatr1 PE=2 SV=1
3	Q96ES5	0.0	718	349	0.161	0.991	Q96ES5_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=1
4	Q9H583	0.0	4370	2144	1.000	1.000	HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3
5	F4JAY0	3.65e-55	216	2199	0.107	0.105	F4JAY0_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g06530 PE=1 SV=1
6	P42945	2.06e-35	151	1769	0.106	0.128	UTP10_YEAST U3 small nucleolar RNA-associated protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP10 PE=1 SV=1
7	Q38FN3	3.02e-17	91.7	2631	0.031	0.025	Q38FN3_TRYB2 HEAT repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1560 PE=3 SV=1
8	Q7TNP2	1.5	36.2	601	0.020	0.070	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
9	Q5H9R4	3.3	35.4	2290	0.007	0.007	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
10	Q9SU30	4.7	34.7	413	0.016	0.085	CPR1_ARATH F-box protein CPR1 OS=Arabidopsis thaliana OX=3702 GN=CPR1 PE=1 SV=2
11	Q5LSQ6	8.7	33.5	444	0.021	0.101	Q5LSQ6_RUEPO Branched-chain amino acid ABC transporter, periplasmic substrate-binding protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO1710 PE=4 SV=1
12	P88958	8.9	33.9	545	0.013	0.051	P88958_HHV8 Packaging protein UL32 OS=Human herpesvirus 8 type M OX=435895 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08146 BP28CT	4.3e-39	145.3	BP28CT (NUC211) domain
2	PF12717 Cnd1	13	17.3	non-SMC mitotic condensation complex subunit 1
3	PF02985 HEAT	6.8e-07	40.0	HEAT repeat
4	PF13646 HEAT_2	0.14	23.9	HEAT repeats
5	PF13513 HEAT_EZ	2.3	20.1	HEAT-like repeat
6	PF10363 RTP1_C1	24	16.5	Required for nuclear transport of RNA pol II C-terminus 1
7	PF12397 U3snoRNP10	7.6e-22	89.2	U3 small nucleolar RNA-associated protein 10
8	PF12755 Vac14_Fab1_bd	1.3e+02	14.6	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225298	0.999	U3 small nucleolar RNA-associated protein 18 homolog
2	9606.ENSP00000232888	0.999	U3 small nucleolar RNA-interacting protein 2
3	9606.ENSP00000261637	0.999	Small subunit processome component 20 homolog
4	9606.ENSP00000261708	0.999	U3 small nucleolar RNA-associated protein 6 homolog
5	9606.ENSP00000264279	0.999	Nucleolar protein 58
6	9606.ENSP00000296792	0.999	U3 small nucleolar RNA-associated protein 15 homolog
7	9606.ENSP00000297579	0.999	DDB1- and CUL4-associated factor 13
8	9606.ENSP00000297990	0.999	Nucleolar protein 6
9	9606.ENSP00000314193	0.999	WD repeat-containing protein 75
10	9606.ENSP00000327179	0.999	U3 small nucleolar RNA-associated protein 4 homolog
11	9606.ENSP00000358812	0.999	Protein RRP5 homolog
12	9606.ENSP00000363642	0.999	Ribosome biogenesis protein BMS1 homolog
13	9606.ENSP00000363746	0.999	WD repeat-containing protein 46
14	9606.ENSP00000370589	0.999	Nucleolar protein 56
15	9606.ENSP00000384302	0.999	WD repeat-containing protein 43
16	9606.ENSP00000423067	0.999	WD repeat-containing protein 36
17	9606.ENSP00000454836	0.999	Transducin beta-like protein 3
18	9606.ENSP00000244230	0.998	U3 small nucleolar ribonucleoprotein protein MPP10
19	9606.ENSP00000254803	0.998	Something about silencing protein 10
20	9606.ENSP00000308179	0.998	WD repeat-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0006356	0.943	regulation of transcription by RNA polymerase I
GO:0031325	0.934	positive regulation of cellular metabolic process
GO:0010557	0.932	positive regulation of macromolecule biosynthetic process
GO:0051254	0.922	positive regulation of RNA metabolic process
GO:0031328	0.866	positive regulation of cellular biosynthetic process
GO:0045943	0.846	positive regulation of transcription by RNA polymerase I
GO:0009987	0.794	cellular process
GO:0071704	0.791	organic substance metabolic process
GO:0044238	0.783	primary metabolic process
GO:0044237	0.778	cellular metabolic process
GO:0006807	0.758	nitrogen compound metabolic process
GO:0043170	0.689	macromolecule metabolic process
GO:0034641	0.675	cellular nitrogen compound metabolic process
GO:0010467	0.505	gene expression
GO:0006139	0.455	nucleobase-containing compound metabolic process
GO:0090304	0.452	nucleic acid metabolic process
GO:0071840	0.375	cellular component organization or biogenesis
GO:0016070	0.351	RNA metabolic process
GO:0006396	0.336	RNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0001650	1.000	fibrillar center
GO:0005654	0.998	nucleoplasm
GO:0016020	0.983	membrane
GO:0032991	0.449	protein-containing complex
GO:0005829	0.304	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]