StarFunc result for job id Q9H598

User Input

>input (525 residues)
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35458	0.777	0.777	1.719E-59	525	0.987	0.987	O35458.pdb.gz	VIAAT_RAT Vesicular inhibitory amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc32a1 PE=1 SV=1
2	AFDB:A1Z9M6	0.726	0.695	3.046E-35	549	0.413	0.395	A1Z9M6.pdb.gz	A1Z9M6_DROME Vesicular GABA transporter OS=Drosophila melanogaster OX=7227 GN=VGAT PE=4 SV=1
3	AFDB:F4IUW3	0.648	0.620	6.597E-19	550	0.206	0.196	F4IUW3.pdb.gz	AVT1C_ARATH Amino acid transporter AVT1C OS=Arabidopsis thaliana OX=3702 GN=AVT1C PE=1 SV=1
4	AFDB:Q9FKY3	0.677	0.826	8.851E-19	427	0.192	0.237	Q9FKY3.pdb.gz	AVT3A_ARATH Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1
5	AFDB:Q9SF09	0.708	0.853	1.291E-18	432	0.189	0.229	Q9SF09.pdb.gz	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
6	AFDB:O80668	0.663	0.649	1.347E-18	536	0.194	0.190	O80668.pdb.gz	AVT1A_ARATH Amino acid transporter AVT1A OS=Arabidopsis thaliana OX=3702 GN=AVT1A PE=2 SV=2
7	AFDB:Q9SVG0	0.672	0.803	5.854E-18	436	0.194	0.234	Q9SVG0.pdb.gz	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
8	AFDB:Q8K415	0.700	0.762	1.195E-17	481	0.192	0.210	Q8K415.pdb.gz	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
9	AFDB:F4ILY9	0.669	0.842	3.559E-17	413	0.190	0.242	F4ILY9.pdb.gz	AVT3B_ARATH Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1
10	AFDB:D2Y3F6	0.694	0.759	7.267E-17	478	0.164	0.180	D2Y3F6.pdb.gz	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
11	PDB:7kgvB	0.586	0.747	8.902E-10	404	0.131	0.171	7kgvB.pdb.gz
12	PDB:7kgvA	0.513	0.723	8.645E-8	361	0.135	0.197	7kgvA.pdb.gz
13	PDB:7cmhB	0.577	0.651	3.313E-7	458	0.120	0.138	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
14	PDB:7p9uB	0.574	0.652	5.257E-7	455	0.097	0.112	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
15	PDB:7dskB	0.501	0.555	2.014E-6	464	0.130	0.147	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
16	PDB:6jmqA	0.511	0.642	3.476E-6	403	0.126	0.164	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
17	PDB:4djiA	0.560	0.592	4.112E-6	493	0.128	0.136	4djiA.pdb.gz
18	PDB:5j4nA	0.513	0.597	7.097E-6	437	0.109	0.130	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
19	PDB:6li9B	0.535	0.602	8.050E-6	458	0.091	0.105	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
20	PDB:7s1xB	0.475	0.309	1.036E-5	871	0.124	0.075	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35458	0.0	1056	525	0.987	0.987	VIAAT_RAT Vesicular inhibitory amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc32a1 PE=1 SV=1
2	O35633	0.0	1058	525	0.987	0.987	VIAAT_MOUSE Vesicular inhibitory amino acid transporter OS=Mus musculus OX=10090 GN=Slc32a1 PE=1 SV=3
3	Q9H598	0.0	1077	525	1.000	1.000	VIAAT_HUMAN Vesicular inhibitory amino acid transporter OS=Homo sapiens OX=9606 GN=SLC32A1 PE=2 SV=2
4	A1Z9M6	6.07e-137	409	549	0.383	0.366	A1Z9M6_DROME Vesicular GABA transporter OS=Drosophila melanogaster OX=7227 GN=VGAT PE=4 SV=1
5	P34579	2.27e-107	331	486	0.347	0.374	UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans OX=6239 GN=unc-47 PE=1 SV=2
6	F4IUW3	2.15e-23	105	550	0.198	0.189	AVT1C_ARATH Amino acid transporter AVT1C OS=Arabidopsis thaliana OX=3702 GN=AVT1C PE=1 SV=1
7	O80668	3.64e-23	105	536	0.183	0.179	AVT1A_ARATH Amino acid transporter AVT1A OS=Arabidopsis thaliana OX=3702 GN=AVT1A PE=2 SV=2
8	F4ILY9	2.83e-20	95.5	413	0.204	0.259	AVT3B_ARATH Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1
9	Q9SVG0	7.15e-17	85.1	436	0.215	0.259	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
10	Q9SF09	1.63e-16	84.0	432	0.204	0.248	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
11	Q495M3	2.10e-16	84.0	483	0.202	0.219	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
12	F4J1Q9	7.76e-14	75.5	405	0.190	0.247	AVT1I_ARATH Amino acid transporter AVT1I OS=Arabidopsis thaliana OX=3702 GN=AVT1I PE=3 SV=1
13	D2Y3F6	3.21e-12	70.9	478	0.189	0.207	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q7Z2H8	3.65e-12	70.9	476	0.189	0.208	S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC36A1 PE=1 SV=1
15	Q9FKY3	7.61e-12	69.7	427	0.196	0.241	AVT3A_ARATH Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1
16	P47082	2.31e-11	68.6	602	0.221	0.193	AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT1 PE=1 SV=1
17	Q8K4D3	7.10e-11	66.6	475	0.120	0.133	S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=1 SV=1
18	Q8BHK3	7.28e-11	66.6	478	0.183	0.201	S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc36a2 PE=1 SV=1
19	Q924A5	7.42e-11	66.6	475	0.116	0.128	S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc36a1 PE=1 SV=1
20	Q54CB3	3.70e-10	64.3	455	0.177	0.204	Q54CB3_DICDI Amino acid transporter transmembrane domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293074 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	2.1e-95	331.5	Transmembrane amino acid transporter protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217420

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350928	0.997	Glutamate decarboxylase 1
2	9606.ENSP00000365437	0.996	Glutamate decarboxylase 2
3	9606.ENSP00000221485	0.989	Vesicular glutamate transporter 1
4	9606.ENSP00000263160	0.989	Vesicular glutamate transporter 2
5	9606.ENSP00000363229	0.976	Vesicular acetylcholine transporter
6	9606.ENSP00000316909	0.965	Vesicular glutamate transporter 3
7	9606.ENSP00000261205	0.952	Synaptotagmin-1
8	9606.ENSP00000354111	0.943	DnaJ homolog subfamily C member 5
9	9606.ENSP00000298472	0.941	Synaptic vesicular amine transporter
10	9606.ENSP00000387549	0.924	Chromaffin granule amine transporter
11	9606.ENSP00000314214	0.918	Vesicle-associated membrane protein 2
12	9606.ENSP00000417901	0.916	Gephyrin
13	9606.ENSP00000222256	0.899	Ras-related protein Rab-3A
14	9606.ENSP00000287766	0.899	Sodium- and chloride-dependent GABA transporter 1
15	9606.ENSP00000254976	0.888	Synaptosomal-associated protein 25
16	9606.ENSP00000432083	0.873	Heat shock cognate 71 kDa protein
17	9606.ENSP00000216200	0.849	Parvalbumin alpha
18	9606.ENSP00000295987	0.822	Synapsin-1
19	9606.ENSP00000267085	0.798	Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L- alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3- sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate
20	9606.ENSP00000282538	0.798	Acidic amino acid decarboxylase GADL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022853	1.000	active monoatomic ion transmembrane transporter activity
GO:0015078	1.000	proton transmembrane transporter activity
GO:0015185	1.000	gamma-aminobutyric acid transmembrane transporter activity
GO:0015355	1.000	secondary active monocarboxylate transmembrane transporter activity
GO:0015297	0.997	antiporter activity
GO:0015187	0.997	glycine transmembrane transporter activity
GO:0005488	0.706	binding
GO:0005515	0.674	protein binding
GO:1901702	0.539	salt transmembrane transporter activity
GO:0140848	0.466	amino acid:monoatomic cation antiporter activity
GO:0140800	0.444	gamma-aminobutyric acid:proton antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.969	cellular process
GO:0051179	0.966	localization
GO:0006810	0.947	transport
GO:0015804	0.821	neutral amino acid transport
GO:0065007	0.748	biological regulation
GO:0015800	0.715	acidic amino acid transport
GO:0006836	0.409	neurotransmitter transport
GO:0015807	0.385	L-amino acid transport
GO:0050789	0.368	regulation of biological process
GO:0007154	0.347	cell communication
GO:0023052	0.346	signaling
GO:0050794	0.332	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.998	cell periphery
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0098793	0.997	presynapse
GO:0012505	0.993	endomembrane system
GO:0005886	0.989	plasma membrane
GO:0031090	0.968	organelle membrane
GO:0031982	0.965	vesicle
GO:0031410	0.943	cytoplasmic vesicle
GO:0098588	0.915	bounding membrane of organelle
GO:0042995	0.781	cell projection
GO:0030659	0.771	cytoplasmic vesicle membrane
GO:0099503	0.745	secretory vesicle
GO:0120025	0.732	plasma membrane bounded cell projection
GO:0030133	0.722	transport vesicle
GO:0043005	0.701	neuron projection
GO:0070382	0.699	exocytic vesicle
GO:0008021	0.694	synaptic vesicle
GO:0099501	0.668	exocytic vesicle membrane
GO:0097447	0.659	dendritic tree
GO:0030672	0.619	synaptic vesicle membrane
GO:0060198	0.333	clathrin-sculpted vesicle
GO:0030425	0.313	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]