StarFunc result for job id Q9H5I1

User Input

>input (410 residues)
MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H5I1	1.000	1.000	3.800E-87	410	1.000	1.000	Q9H5I1.pdb.gz	SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens OX=9606 GN=SUV39H2 PE=1 SV=2
2	AFDB:Q9EQQ0	0.937	0.807	9.759E-77	477	0.888	0.763	Q9EQQ0.pdb.gz	SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus OX=10090 GN=Suv39h2 PE=1 SV=1
3	AFDB:B1H256	0.891	0.886	8.078E-62	412	0.593	0.590	B1H256.pdb.gz	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
4	AFDB:Q6DGD3	0.888	0.886	1.997E-60	411	0.554	0.552	Q6DGD3.pdb.gz	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
5	AFDB:A0A2R8QCU6	0.885	0.843	2.312E-59	431	0.561	0.534	A0A2R8QCU6.pdb.gz
6	AFDB:P45975	0.653	0.427	1.242E-39	635	0.376	0.243	P45975.pdb.gz	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
7	AFDB:O60016	0.617	0.525	1.117E-29	490	0.302	0.253	O60016.pdb.gz	CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr4 PE=1 SV=2
8	AFDB:A2ABF8	0.539	0.187	2.262E-23	1233	0.254	0.084	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
9	AFDB:O64827	0.558	0.172	2.262E-23	1382	0.217	0.064	O64827.pdb.gz	SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana OX=3702 GN=SUVR5 PE=1 SV=3
10	AFDB:A2ABF9	0.537	0.182	4.827E-23	1267	0.246	0.080	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
11	PDB:1pegA	0.511	0.774	1.517E-20	266	0.229	0.353	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
12	PDB:7td5A	0.350	0.292	1.246E-13	497	0.146	0.121	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	PDB:5hynA	0.340	0.245	2.508E-13	581	0.141	0.100	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
14	PDB:7td5F	0.350	0.322	9.049E-13	447	0.173	0.159	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:5wg6A	0.345	0.277	1.361E-12	517	0.149	0.118	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
16	PDB:6wkrC	0.351	0.243	2.740E-12	606	0.163	0.111	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
17	PDB:7ksoA	0.342	0.354	4.632E-12	395	0.149	0.154	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
18	PDB:5h6zA	0.246	0.742	1.889E-5	123	0.066	0.220	5h6zA.pdb.gz
19	PDB:2g46A	0.209	0.633	3.199E-3	119	0.061	0.210	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5ex0A	0.103	0.099	5.407E-3	429	0.049	0.047	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EQQ0	0.0	753	477	0.888	0.763	SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus OX=10090 GN=Suv39h2 PE=1 SV=1
2	Q9H5I1	0.0	857	410	1.000	1.000	SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens OX=9606 GN=SUV39H2 PE=1 SV=2
3	O43463	3.05e-172	489	412	0.588	0.585	SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens OX=9606 GN=SUV39H1 PE=1 SV=1
4	B1H256	3.19e-171	486	412	0.593	0.590	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
5	A0A8I6AJD7	3.28e-171	487	414	0.588	0.582	A0A8I6AJD7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
6	O54864	4.78e-171	486	412	0.593	0.590	SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus OX=10090 GN=Suv39h1 PE=1 SV=1
7	A0A8I6A0U8	3.77e-170	485	438	0.588	0.550	A0A8I6A0U8_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
8	Q6DGD3	6.72e-164	468	411	0.561	0.560	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
9	B0S6M0	3.24e-160	459	421	0.559	0.544	B0S6M0_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=fe47h06 PE=1 SV=1
10	A0A8I6A3A4	4.68e-153	442	445	0.554	0.510	A0A8I6A3A4_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
11	A0A8I5ZJE7	2.27e-104	312	286	0.371	0.531	A0A8I5ZJE7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
12	P45975	1.70e-66	224	635	0.368	0.238	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
13	O60016	1.23e-48	174	490	0.256	0.214	CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr4 PE=1 SV=2
14	Q8X225	1.30e-42	154	331	0.215	0.266	DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=dim-5 PE=1 SV=2
15	A8TT22	3.80e-41	157	1173	0.229	0.080	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
16	A2ABF8	7.97e-39	150	1233	0.220	0.073	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
17	A0A024RCN9	8.14e-39	150	1210	0.220	0.074	A0A024RCN9_HUMAN EHMT2 OS=Homo sapiens OX=9606 PE=4 SV=1
18	Q96KQ7	8.14e-39	150	1210	0.220	0.074	EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3
19	A2ABF9	9.26e-39	150	1267	0.220	0.071	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
20	A0A0G2JTA5	1.48e-38	150	1172	0.220	0.077	A0A0G2JTA5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	5.8e-11	53.4	Chromo (CHRromatin Organisation MOdifier) domain
2	PF05033 Pre-SET	1.4e-12	59.6	Pre-SET motif
3	PF00856 SET	3.8e-17	74.7	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301764	0.844	DNA damage-binding protein 1
2	9606.ENSP00000305899	0.826	Histone-lysine N-methyltransferase KMT5B
3	9606.ENSP00000377060	0.824	Chromobox protein homolog 1
4	9606.ENSP00000367755	0.820	Calmodulin-lysine N-methyltransferase
5	9606.ENSP00000476960	0.819	Histone cluster 2 H3 pseudogene 2
6	9606.ENSP00000209875	0.791	Chromobox protein homolog 5
7	9606.ENSP00000255613	0.754	Histone-lysine N-methyltransferase KMT5C
8	9606.ENSP00000383042	0.752	Lysine-specific histone demethylase 1A
9	9606.ENSP00000419184	0.714	Histone-lysine N-methyltransferase SMYD3
10	9606.ENSP00000369666	0.712	F-box/LRR-repeat protein 19
11	9606.ENSP00000274031	0.705	Histone-lysine N-methyltransferase SETD7
12	9606.ENSP00000366135	0.698	Exosome component 10
13	9606.ENSP00000446917	0.689	DCC-interacting protein 13-beta
14	9606.ENSP00000355924	0.666	N-lysine methyltransferase SMYD2
15	9606.ENSP00000437256	0.665	Endoribonuclease Dicer
16	9606.ENSP00000196061	0.660	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
17	9606.ENSP00000223127	0.660	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
18	9606.ENSP00000282903	0.660	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
19	9606.ENSP00000356437	0.659	SAM and SH3 domain-containing protein 1
20	9606.ENSP00000366271	0.652	Lysine-specific demethylase 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0046974	0.999	histone H3K9 methyltransferase activity
GO:0043169	0.998	cation binding
GO:1901681	0.990	sulfur compound binding
GO:1901363	0.987	heterocyclic compound binding
GO:0097159	0.987	organic cyclic compound binding
GO:0003676	0.983	nucleic acid binding
GO:0003677	0.965	DNA binding
GO:0046872	0.939	metal ion binding
GO:0046914	0.917	transition metal ion binding
GO:0008270	0.913	zinc ion binding
GO:1904047	0.881	S-adenosyl-L-methionine binding
GO:0003682	0.864	chromatin binding
GO:0003690	0.559	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.981	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0019222	0.920	regulation of metabolic process
GO:0050896	0.916	response to stimulus
GO:0060255	0.911	regulation of macromolecule metabolic process
GO:0080090	0.895	regulation of primary metabolic process
GO:0051171	0.895	regulation of nitrogen compound metabolic process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0010468	0.882	regulation of gene expression
GO:0010605	0.873	negative regulation of macromolecule metabolic process
GO:0048523	0.861	negative regulation of cellular process
GO:0031326	0.861	regulation of cellular biosynthetic process
GO:0071840	0.857	cellular component organization or biogenesis
GO:0010556	0.856	regulation of macromolecule biosynthetic process
GO:0006355	0.853	regulation of DNA-templated transcription
GO:0009890	0.784	negative regulation of biosynthetic process
GO:0010558	0.765	negative regulation of macromolecule biosynthetic process
GO:0071704	0.764	organic substance metabolic process
GO:0051253	0.764	negative regulation of RNA metabolic process
GO:0016043	0.757	cellular component organization
GO:0031327	0.745	negative regulation of cellular biosynthetic process
GO:0044238	0.731	primary metabolic process
GO:1902679	0.727	negative regulation of RNA biosynthetic process
GO:0006807	0.717	nitrogen compound metabolic process
GO:0043170	0.617	macromolecule metabolic process
GO:0006325	0.610	chromatin organization
GO:0051716	0.603	cellular response to stimulus
GO:0044237	0.574	cellular metabolic process
GO:0045892	0.568	negative regulation of DNA-templated transcription
GO:0042221	0.537	response to chemical
GO:0043412	0.523	macromolecule modification
GO:0036211	0.512	protein modification process
GO:0044260	0.511	cellular macromolecule metabolic process
GO:0048518	0.484	positive regulation of biological process
GO:0006338	0.472	chromatin remodeling
GO:0006357	0.465	regulation of transcription by RNA polymerase II
GO:0006950	0.440	response to stress
GO:0048522	0.369	positive regulation of cellular process
GO:0009628	0.358	response to abiotic stimulus
GO:0010604	0.321	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.999	chromatin
GO:0005654	0.997	nucleoplasm
GO:0032991	0.923	protein-containing complex
GO:0000792	0.554	heterochromatin
GO:0005737	0.349	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	0.999	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]