StarFunc result for job id Q9H5I5

User Input

>input (1400 residues)
MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFSEPTKTTMQGHTGRLL
KSLCFISLSFLLLHIIFHITLVSLEAQHRIAPGYNCSTWEKTFRQIGFESLKGADAGNGI
RVFVPDIGMFIASLTIWLLCRNIVQKPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEE
DFNGGDGVEGELEESTKLKMFRRLASVASKLKEFIGNMITTAGKVVVTILLGSSGMMLPS
LTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPP
NDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQEPL
VQDEGTKEEDKALACSPIQITAGRRRSLWYATHYPTDERKLLSMTQDDYKPSDGLLVTVN
GNPVDYHTIHPSLPMENGPGKADLYSTPQYRWEPSDESSEKREEEEEEKEEFEEERSREE
KRSIKVHAMVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYA
MISSPFMVVYGNLLLILQYIWSFELPEIKKVPGFLEKKEPGELASKILFTITFWLLLRQH
LTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQ
EEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVA
LYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLK
QFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLKSIPSKEDNTIYRLAHPEGSLP
DLTMMHLTASLEKPEVRKLAEPGEEKLEGYSEKAQKGDLGKDSEESEEDGEEEEESEEEE
ETSDLRNKWHLVIDRLTVLFLKFLEYFHKLQVFMWWILELHIIKIVSSYIIWVSVKEVSL
FNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNEN
QTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVYLRNNLLMLAILAFEVTIYRHQEYY
RGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMD
FYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFK
GASFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVE
ICMNLDAASFSQHNPVPDFIHCRSYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGY
LVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNSCW
LIQAFSLACTVKGYQMPAAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6kg7A	0.657	0.508	1.574E-94	1817	0.654	0.504	6kg7A.pdb.gz
2	AFDB:E2JF22	0.720	0.407	1.328E-88	2547	0.392	0.216	E2JF22.pdb.gz	PIEZ1_MOUSE Piezo-type mechanosensitive ion channel component 1 OS=Mus musculus OX=10090 GN=Piezo1 PE=1 SV=1
3	AFDB:E7FD74	0.657	0.391	8.865E-85	2436	0.392	0.225	E7FD74.pdb.gz
4	AFDB:Q92508	0.620	0.367	2.087E-84	2521	0.394	0.219	Q92508.pdb.gz	PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4
5	AFDB:M9MSG8	0.601	0.353	5.120E-57	2551	0.259	0.142	M9MSG8.pdb.gz	PIEZO_DROME Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1
6	AFDB:A0A061ACU2	0.546	0.340	2.235E-48	2442	0.225	0.129	A0A061ACU2.pdb.gz	PIEZ1_CAEEL Piezo-type mechanosensitive ion channel component 1 OS=Caenorhabditis elegans OX=6239 GN=pezo-1 PE=1 SV=1
7	PDB:6b3rA	0.399	0.372	1.074E-35	1502	0.222	0.207	6b3rA.pdb.gz	Structure-based membrane dome mechanism for Piezo mechanosensitivity.
8	PDB:7wluA	0.357	0.334	1.953E-26	1498	0.223	0.208	7wluA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
9	PDB:7wltA	0.283	0.293	9.991E-24	1353	0.164	0.170	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
10	PDB:5z10A	0.294	0.314	6.944E-20	1304	0.184	0.198	5z10A.pdb.gz
11	AFDB:Q9XID5	0.046	0.072	3.022E-1	657	0.041	0.088	Q9XID5.pdb.gz	PSI1_ARATH Protein PSK SIMULATOR 1 OS=Arabidopsis thaliana OX=3702 GN=PSI1 PE=1 SV=2
12	AFDB:Q8LPK7	0.039	0.075	5.348E-1	678	0.060	0.124	Q8LPK7.pdb.gz	Q8LPK7_ARATH Paramyosin OS=Arabidopsis thaliana OX=3702 GN=PUF2 PE=1 SV=1
13	AFDB:P18011	0.055	0.113	7.115E-1	580	0.051	0.124	P18011.pdb.gz	SCTE_SHIFL Type 3 secretion system translocon protein SctE OS=Shigella flexneri OX=623 GN=sctE PE=1 SV=2
14	AFDB:O43823	0.046	0.072	7.411E-1	692	0.035	0.071	O43823.pdb.gz	AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1
15	AFDB:O14248	0.049	0.059	1.366	1125	0.070	0.087	O14248.pdb.gz	TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tea3 PE=1 SV=1
16	PDB:7w9lA	0.047	0.047	1.693	1420	0.059	0.058	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
17	PDB:7stmA	0.066	0.102	2.651	801	0.032	0.056	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
18	PDB:6x15A	0.056	0.133	3.527	419	0.030	0.100	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
19	PDB:7wq3R	0.050	0.151	3.986	289	0.034	0.163	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
20	PDB:7b93N	0.067	0.187	4.151	345	0.033	0.133	7b93N.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2JF22	0.0	777	2547	0.303	0.166	PIEZ1_MOUSE Piezo-type mechanosensitive ion channel component 1 OS=Mus musculus OX=10090 GN=Piezo1 PE=1 SV=1
2	Q8CD54	0.0	2444	2822	0.904	0.448	PIEZ2_MOUSE Piezo-type mechanosensitive ion channel component 2 OS=Mus musculus OX=10090 GN=Piezo2 PE=1 SV=2
3	Q92508	0.0	918	2521	0.398	0.221	PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4
4	M9MSG8	1.24e-126	438	2551	0.274	0.150	PIEZO_DROME Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1
5	A0A061ACU2	5.88e-70	262	2442	0.216	0.124	PIEZ1_CAEEL Piezo-type mechanosensitive ion channel component 1 OS=Caenorhabditis elegans OX=6239 GN=pezo-1 PE=1 SV=1
6	Q54S52	8.88e-04	46.6	3080	0.026	0.012	Y2801_DICDI Protein PIEZO homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282801 PE=3 SV=1
7	E9PQD2	0.054	38.9	179	0.016	0.128	E9PQD2_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
8	O84677	0.18	37.0	168	0.021	0.173	O84677_CHLTR Type III secretion T3S chaperone OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=CT_670 PE=1 SV=1
9	E9PIG0	0.24	36.6	162	0.016	0.136	E9PIG0_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
10	A0A0B4JD82	0.25	38.5	7905	0.016	0.003	A0A0B4JD82_DROME Stretchin-Mlck, isoform T OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
11	A0A0B4KF84	0.25	38.5	8216	0.016	0.003	A0A0B4KF84_DROME Stretchin-Mlck, isoform S OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
12	A0A0B4KG35	0.25	38.5	8255	0.016	0.003	A0A0B4KG35_DROME Stretchin-Mlck, isoform U OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
13	A1ZA72	0.25	38.5	7944	0.016	0.003	A1ZA72_DROME Stretchin-Mlck, isoform V OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=2
14	P17536	0.25	37.0	199	0.015	0.106	TPM1_YEAST Tropomyosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPM1 PE=1 SV=1
15	Q8IDY5	0.25	38.1	459	0.014	0.044	Q8IDY5_PLAF7 MSP7-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1334300 PE=4 SV=1
16	Q9SZP8	0.27	37.7	452	0.012	0.038	IF4B3_ARATH Eukaryotic translation initiation factor 4B3 OS=Arabidopsis thaliana OX=3702 GN=EIF4B3 PE=1 SV=1
17	C6KTF3	0.31	37.4	323	0.016	0.068	C6KTF3_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632100 PE=4 SV=1
18	Q8II80	0.48	37.4	1570	0.014	0.012	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
19	E9QCV2	0.64	37.0	4530	0.023	0.007	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
20	A0A0R4IJ71	0.66	37.0	4506	0.023	0.007	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03235 DUF262	6e+02	12.0	Protein of unknown function DUF262
2	PF15917 PIEZO	8.1e-07	40.3	Piezo

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368952	0.854	Stomatin-like protein 3
2	9606.ENSP00000262209	0.816	Transient receptor potential cation channel subfamily A member 1
3	9606.ENSP00000286713	0.771	Erythrocyte band 7 integral membrane protein
4	9606.ENSP00000353346	0.743	LHFPL tetraspan subfamily member 5 protein
5	9606.ENSP00000459962	0.728	Transient receptor potential cation channel, subfamily V, member 1
6	9606.ENSP00000461007	0.728	Transient receptor potential cation channel subfamily V member 1
7	9606.ENSP00000324775	0.657	Transmembrane inner ear expressed protein
8	9606.ENSP00000420919	0.655	Transmembrane protein 150C
9	9606.ENSP00000351732	0.652	Transmembrane channel-like protein 2
10	9606.ENSP00000297784	0.642	Transmembrane channel-like protein 1
11	9606.ENSP00000257861	0.641	Advillin
12	9606.ENSP00000406191	0.640	Transient receptor potential cation channel subfamily V member 4
13	9606.ENSP00000297512	0.621	Acid-sensing ion channel 3
14	9606.ENSP00000461945	0.614	Ras-related protein Rab-31
15	9606.ENSP00000444948	0.611	Potassium channel subfamily K member 4
16	9606.ENSP00000394033	0.609	Potassium channel subfamily K member 2
17	9606.ENSP00000323926	0.586	Transient receptor potential cation channel subfamily M member 8
18	9606.ENSP00000390600	0.562	Sodium channel protein type 10 subunit alpha
19	9606.ENSP00000225823	0.539	Acid sensing ion channel subunit 2
20	9606.ENSP00000304908	0.533	Thioredoxin domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005261	1.000	monoatomic cation channel activity
GO:0008381	1.000	mechanosensitive monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.966	biological regulation
GO:0006811	0.922	monoatomic ion transport
GO:0050896	0.907	response to stimulus
GO:0006812	0.906	monoatomic cation transport
GO:0050877	0.905	nervous system process
GO:0007600	0.891	sensory perception
GO:0065008	0.889	regulation of biological quality
GO:0009612	0.832	response to mechanical stimulus
GO:0042391	0.748	regulation of membrane potential
GO:0009582	0.678	detection of abiotic stimulus
GO:0050954	0.665	sensory perception of mechanical stimulus
GO:0009581	0.661	detection of external stimulus
GO:0050906	0.647	detection of stimulus involved in sensory perception
GO:0050982	0.634	detection of mechanical stimulus
GO:0050974	0.473	detection of mechanical stimulus involved in sensory perception
GO:0009987	0.403	cellular process
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]