StarFunc result for job id Q9H5P4

User Input

>input (1033 residues)
MAQGFAVGFDPLGLGDLSSGSLSSLSSRGHLGSDSGSTATRYLLRKQQRLLNGPPRGIRA
SSPMGRVILINSPIEANSDESDIIHSVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGS
SAERAGLCVGDKITEVNGLSLESTTMGSAVKVLTSSSRLHMMVRRMGRVPGIKFSKEKTT
WVDVVNRRLVVEKCGSTPSDTSSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSK
VDHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKGQTHIMLTIKETGRYPAYKEM
VSEYCWLDRLSNGVLQQLSPASESSSSVSSCASSAPYSSGSLPSDRMDICLGQEEPGSRG
PGWGRADTAMQTEPDAGGRVETWCSVRPTVILRDTAIRSDGPHPGRRLDSALSESPKTAL
LLALSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRL
ARDGRREAWTLDSGSLAKTYPRLDIEKAGGVGPVQKFVTWRLRRDQERGRALLSARSGSP
SSQLPNVDEQVQAWESRRPLIQDLAQRLLTDDEVLAVTRHCSRYVHEGGIEDLVRPLLAI
LDRPEKLLLLQDIRSVVAPTDLGRFDSMVMLVELEAFEALKSRAVRPPALRPARQDTPPK
RHLITPVPDSRGGFYLLPVNGFPEEEDNGELRERLGALKVSPSASAPRHPHKGIPPLQDV
PVDAFTPLRIACTPPPQLPPVAPRPLRPNWLLTEPLSREHPPQSQIRGRAQSRSRSRSRS
RSRSSRGQGKSPGRRSPSPVPTPAPSMTNGRYHKPRKARPPLPRPLDGEAAKVGAKQGPS
ESGTEGTAKEAAMKNPSGELKTVTLSKMKQSLGISISGGIESKVQPMVKIEKIFPGGAAF
LSGALQAGFELVAVDGENLEQVTHQRAVDTIRRAYRNKAREPMELVVRVPGPSPRPSPSD
SSALTDGGLPADHLPAHQPLDAAPVPAHWLPEPPTNPQTPPTDARLLQPTPSPAPSPALQ
TPDSKPAPSPRIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q9W7	0.498	0.503	0.000	1021	0.828	0.837	E9Q9W7.pdb.gz	PDZD7_MOUSE PDZ domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pdzd7 PE=1 SV=2
2	AFDB:Q9H5P4	0.999	0.999	0.000	1033	1.000	1.000	Q9H5P4.pdb.gz	PDZD7_HUMAN PDZ domain-containing protein 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=2
3	AFDB:A0A0R4IEP0	0.318	0.339	1.087E-77	955	0.447	0.484	A0A0R4IEP0.pdb.gz
4	PDB:7pc5A	0.089	0.227	1.035E-13	405	0.089	0.227	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
5	AFDB:Q9VKG8	0.088	0.053	1.998E-11	1916	0.187	0.101	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
6	PDB:2xkxA	0.089	0.120	4.324E-11	721	0.068	0.097	2xkxA.pdb.gz
7	AFDB:D3YZU1	0.084	0.044	1.714E-8	2167	0.197	0.094	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
8	AFDB:F1RCC9	0.090	0.082	3.151E-8	1179	0.129	0.113	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
9	AFDB:A0A1D5NS76	0.088	0.053	3.331E-8	2005	0.183	0.094	A0A1D5NS76.pdb.gz
10	AFDB:A0A0B4K6Y7	0.084	0.041	4.643E-8	2395	0.191	0.082	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
11	AFDB:Q9JLU4	0.091	0.059	4.907E-8	1740	0.172	0.102	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
12	AFDB:Q8TEU7	0.082	0.060	2.583E-7	1601	0.145	0.094	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
13	PDB:7pc3A	0.085	0.212	6.599E-7	405	0.031	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7qqnC	0.075	0.183	1.889E-6	414	0.023	0.058	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6pcvA	0.069	0.094	2.231E-6	754	0.048	0.066	6pcvA.pdb.gz
16	PDB:7p70A	0.080	0.200	2.784E-6	407	0.028	0.071	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:6t36A	0.080	0.845	3.287E-6	93	0.021	0.237	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:3pv2B	0.056	0.137	1.051E-5	388	0.042	0.111	3pv2B.pdb.gz
19	PDB:7p73A	0.081	0.194	1.111E-5	420	0.026	0.064	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pe9I	0.088	0.270	3.553E-5	317	0.022	0.073	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y892	0.0	1026	561	0.491	0.904	A0A2R8Y892_HUMAN PDZ domain containing 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=1
2	A0A2R8YFN1	0.0	1028	573	0.492	0.887	A0A2R8YFN1_HUMAN PDZ domain containing 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=1
3	D6BNA9	0.0	752	954	0.454	0.492	D6BNA9_DANRE PDZ domain containing protein 7a OS=Danio rerio OX=7955 GN=si:dkey-158p2.1 PE=2 SV=1
4	E9Q9W7	0.0	1471	1021	0.822	0.832	PDZD7_MOUSE PDZ domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pdzd7 PE=1 SV=2
5	Q9H5P4	0.0	2071	1033	1.000	1.000	PDZD7_HUMAN PDZ domain-containing protein 7 OS=Homo sapiens OX=9606 GN=PDZD7 PE=1 SV=2
6	Q80VW5	1.51e-43	174	918	0.098	0.110	WHRN_MOUSE Whirlin OS=Mus musculus OX=10090 GN=Whrn PE=1 SV=3
7	Q810W9	4.18e-43	172	920	0.099	0.111	WHRN_RAT Whirlin OS=Rattus norvegicus OX=10116 GN=Whrn PE=1 SV=1
8	Q9P202	1.22e-42	171	907	0.099	0.112	WHRN_HUMAN Whirlin OS=Homo sapiens OX=9606 GN=WHRN PE=1 SV=4
9	A0A8I5ZR66	6.98e-22	104	910	0.064	0.073	A0A8I5ZR66_RAT USH1 protein network component harmonin OS=Rattus norvegicus OX=10116 GN=Ush1c PE=4 SV=1
10	Q9ES64	8.64e-22	104	910	0.065	0.074	USH1C_MOUSE Harmonin OS=Mus musculus OX=10090 GN=Ush1c PE=1 SV=1
11	A0A0S2Z4U9	3.38e-21	101	552	0.065	0.121	A0A0S2Z4U9_HUMAN Usher syndrome 1C (Autosomal recessive, severe), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=USH1C PE=2 SV=1
12	Q9Y6N9	3.38e-21	101	552	0.065	0.121	USH1C_HUMAN Harmonin OS=Homo sapiens OX=9606 GN=USH1C PE=1 SV=3
13	Q29RC0	8.74e-21	100	548	0.065	0.122	Q29RC0_DANRE Harmonin OS=Danio rerio OX=7955 GN=zgc:136806 PE=1 SV=1
14	A0A8I6A2P6	1.30e-20	99.4	535	0.067	0.129	A0A8I6A2P6_RAT USH1 protein network component harmonin OS=Rattus norvegicus OX=10116 GN=Ush1c PE=4 SV=1
15	A0A0S2Z4V1	1.80e-18	92.4	533	0.061	0.118	A0A0S2Z4V1_HUMAN Usher syndrome 1C (Autosomal recessive, severe), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=USH1C PE=2 SV=1
16	A0A8I5Y9F7	8.46e-18	90.5	529	0.062	0.121	A0A8I5Y9F7_RAT USH1 protein network component harmonin OS=Rattus norvegicus OX=10116 GN=Ush1c PE=4 SV=1
17	G3I1T3	1.13e-15	85.1	2352	0.067	0.029	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
18	M9PF56	2.40e-13	77.0	1254	0.038	0.031	M9PF56_DROME Dyschronic, isoform G OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
19	B7Z049	2.96e-13	76.3	689	0.039	0.058	B7Z049_DROME Dyschronic, isoform F OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1
20	M9PI53	3.10e-13	76.6	982	0.039	0.041	M9PI53_DROME Dyschronic, isoform J OS=Drosophila melanogaster OX=7227 GN=dysc PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00937 CoV_nucleocap	1.4e+02	12.9	Coronavirus nucleocapsid
2	PF00595 PDZ	2.8e-42	154.3	PDZ domain
3	PF13180 PDZ_2	2.3e-07	42.4	PDZ domain
4	PF17820 PDZ_6	7.6e-18	75.5	PDZ domain
5	PF02163 Peptidase_M50	5.7e-07	40.7	Peptidase family M50
6	PF14685 Tricorn_PDZ	6	18.2	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384582	0.978	G-protein coupled receptor 98
2	9606.ENSP00000305941	0.967	Usherin
3	9606.ENSP00000386331	0.891	Unconventional myosin-VIIa
4	9606.ENSP00000410083	0.876	Vezatin
5	9606.ENSP00000480279	0.834	Usher syndrome type-1G protein
6	9606.ENSP00000354623	0.824	Whirlin
7	9606.ENSP00000306678	0.787	Ankyrin repeat and kinase domain containing 1
8	9606.ENSP00000258930	0.784	Calcium and integrin-binding family member 2
9	9606.ENSP00000329158	0.784	Clarin-1
10	9606.ENSP00000363068	0.747	Protocadherin-15
11	9606.ENSP00000381768	0.746	Cadherin-23
12	9606.ENSP00000265715	0.718	Pendrin
13	9606.ENSP00000005226	0.710	Harmonin
14	9606.ENSP00000329797	0.707	Cell adhesion molecule 1
15	9606.ENSP00000332809	0.694	Uncharacterized protein C2orf71
16	9606.ENSP00000415090	0.657	Unconventional myosin-VIIb
17	9606.ENSP00000205890	0.648	Unconventional myosin-XV
18	9606.ENSP00000372295	0.640	Gap junction beta-2 protein
19	9606.ENSP00000380661	0.616	Centrosome-associated protein CEP250
20	9606.ENSP00000294600	0.591	Coiled-coil domain containing 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.688	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0032501	0.961	multicellular organismal process
GO:0007605	0.921	sensory perception of sound
GO:0032502	0.918	developmental process
GO:0016043	0.905	cellular component organization
GO:0048856	0.900	anatomical structure development
GO:0060113	0.821	inner ear receptor cell differentiation
GO:0050896	0.756	response to stimulus
GO:0051179	0.733	localization
GO:0050906	0.675	detection of stimulus involved in sensory perception
GO:0009582	0.674	detection of abiotic stimulus
GO:0009581	0.674	detection of external stimulus
GO:0009612	0.669	response to mechanical stimulus
GO:0050974	0.638	detection of mechanical stimulus involved in sensory perception
GO:0090596	0.588	sensory organ morphogenesis
GO:0031175	0.568	neuron projection development
GO:0060119	0.567	inner ear receptor cell development
GO:0042472	0.547	inner ear morphogenesis
GO:0060122	0.526	inner ear receptor cell stereocilium organization
GO:0050910	0.490	detection of mechanical stimulus involved in sensory perception of sound
GO:0060117	0.480	auditory receptor cell development
GO:0048667	0.479	cell morphogenesis involved in neuron differentiation
GO:0065007	0.307	biological regulation
GO:0050794	0.302	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0070013	0.991	intracellular organelle lumen
GO:0120025	0.988	plasma membrane bounded cell projection
GO:0005654	0.980	nucleoplasm
GO:0005576	0.944	extracellular region
GO:0005737	0.923	cytoplasm
GO:0005615	0.878	extracellular space
GO:0016020	0.870	membrane
GO:0032991	0.645	protein-containing complex
GO:0005929	0.447	cilium
GO:0043005	0.376	neuron projection
GO:0098862	0.363	cluster of actin-based cell projections

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]