StarFunc result for job id Q9H5Q4

User Input

>input (396 residues)
MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNP
PRKASKASLDFKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKV
VALESDKTFIPHLESLGKNLDGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEA
VPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMAD
PGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQ
MIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDE
KVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H5Q4	1.000	1.000	1.863E-80	396	1.000	1.000	Q9H5Q4.pdb.gz	TFB2M_HUMAN Dimethyladenosine transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TFB2M PE=1 SV=1
2	PDB:6erpF	0.718	0.986	7.803E-53	288	0.727	1.000	6erpF.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
3	AFDB:Q3TL26	0.793	0.793	1.521E-50	396	0.528	0.528	Q3TL26.pdb.gz	TFB2M_MOUSE Dimethyladenosine transferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tfb2m PE=2 SV=1
4	AFDB:Q54M56	0.611	0.507	6.977E-21	485	0.157	0.128	Q54M56.pdb.gz	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
5	AFDB:Q8WVM0	0.583	0.659	3.926E-20	346	0.149	0.171	Q8WVM0.pdb.gz	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
6	AFDB:Q8JZM0	0.569	0.645	4.943E-20	345	0.152	0.174	Q8JZM0.pdb.gz	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
7	PDB:4gc5A	0.578	0.705	1.801E-19	319	0.152	0.188	4gc5A.pdb.gz
8	PDB:6ajkA	0.569	0.745	7.172E-19	293	0.146	0.198	6ajkA.pdb.gz	Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
9	AFDB:Q38BN0	0.574	0.492	9.331E-18	467	0.202	0.171	Q38BN0.pdb.gz	Q38BN0_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3680 PE=3 SV=1
10	AFDB:Q9FK02	0.515	0.534	1.051E-13	380	0.169	0.176	Q9FK02.pdb.gz	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
11	PDB:3tpzB	0.545	0.778	1.142E-13	267	0.131	0.195	3tpzB.pdb.gz
12	AFDB:Q585P9	0.503	0.571	3.521E-13	344	0.167	0.192	Q585P9.pdb.gz	Q585P9_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.360 PE=3 SV=1
13	PDB:7mqaNL	0.492	0.674	1.211E-12	278	0.162	0.230	7mqaNL.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajuJL	0.477	0.645	1.616E-11	283	0.154	0.216	7ajuJL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:6ymwB	0.519	0.596	3.417E-11	340	0.111	0.129	6ymwB.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
16	PDB:4lg1A	0.263	0.424	6.851E-6	217	0.086	0.157	4lg1A.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
17	AFDB:P35551	0.283	0.352	1.777E-5	305	0.104	0.134	P35551.pdb.gz	FBRL_SCHPO rRNA 2'-O-methyltransferase fibrillarin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fib1 PE=1 SV=1
18	PDB:3c0kA	0.307	0.307	2.296E-5	395	0.078	0.078	3c0kA.pdb.gz
19	PDB:4hh4C	0.246	0.358	2.891E-5	256	0.076	0.117	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
20	AFDB:Q5A0V9	0.260	0.311	1.059E-4	316	0.106	0.133	Q5A0V9.pdb.gz	Q5A0V9_CANAL rRNA 2'-O-methyltransferase fibrillarin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NOP1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H5Q4	0.0	820	396	1.000	1.000	TFB2M_HUMAN Dimethyladenosine transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TFB2M PE=1 SV=1
2	Q3TL26	1.75e-151	435	396	0.525	0.525	TFB2M_MOUSE Dimethyladenosine transferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tfb2m PE=2 SV=1
3	Q54M56	5.62e-11	66.2	485	0.111	0.091	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
4	Q8WVM0	2.75e-08	57.4	346	0.111	0.127	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
5	Q8JZM0	9.79e-08	55.8	345	0.126	0.145	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
6	Q9FK02	2.96e-04	45.1	380	0.124	0.129	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
7	O22268	5.94e-04	43.9	353	0.124	0.139	DIM1A_ARATH Ribosomal RNA small subunit methyltransferase OS=Arabidopsis thaliana OX=3702 GN=DIM1A PE=1 SV=1
8	Q585P9	0.002	42.0	344	0.091	0.105	Q585P9_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.360 PE=3 SV=1
9	Q38BN0	0.003	42.0	467	0.066	0.056	Q38BN0_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3680 PE=3 SV=1
10	Q9VH38	0.009	40.4	452	0.136	0.119	TFB2M_DROME Dimethyladenosine transferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtTFB2 PE=2 SV=2
11	A0A0C4DGB1	0.010	40.0	275	0.063	0.091	A0A0C4DGB1_HUMAN rRNA adenine N(6)-methyltransferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
12	Q9UNQ2	0.011	39.7	313	0.063	0.080	DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
13	Q54944	0.016	39.3	287	0.124	0.171	ZTOX_STRPY Toxin zeta OS=Streptococcus pyogenes OX=1314 PE=1 SV=3
14	P41819	0.028	38.5	318	0.058	0.072	DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIM1 PE=1 SV=1
15	O65090	0.072	37.4	343	0.063	0.073	DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PFC1 PE=2 SV=1
16	E5KIC0	0.35	35.0	245	0.051	0.082	CYPM_STRSQ Cypemycin N-terminal methyltransferase OS=Streptomyces sp. OX=1931 GN=cypM PE=1 SV=1
17	Q5DX48	0.79	34.7	2886	0.048	0.007	Q5DX48_CAEEL MOR2-PAG1_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-2 PE=1 SV=1
18	H2KZU6	1.2	33.9	714	0.048	0.027	H2KZU6_CAEEL Protein furry C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-2 PE=1 SV=1
19	Q9NRR4	1.2	33.9	1374	0.101	0.029	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2
20	Q9USU2	1.4	33.1	307	0.053	0.068	DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08221 HTH_9	1.2e+02	14.2	RNA polymerase III subunit RPC82 helix-turn-helix domain
2	PF13649 Methyltransf_25	6.6e+02	12.4	Methyltransferase domain
3	PF00398 RrnaAD	1.7e-16	71.7	Ribosomal RNA adenine dimethylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465759	0.999	DNA-directed RNA polymerase, mitochondrial
2	9606.ENSP00000420588	0.998	Transcription factor A, mitochondrial
3	9606.ENSP00000264867	0.966	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000230340	0.962	Bystin
5	9606.ENSP00000376924	0.958	Nuclear respiratory factor 1
6	9606.ENSP00000263657	0.955	RNA-binding protein PNO1
7	9606.ENSP00000220429	0.951	GA-binding protein subunit beta-1
8	9606.ENSP00000278070	0.948	Peroxisome proliferator-activated receptor gamma coactivator-related protein 1
9	9606.ENSP00000301364	0.945	Pre-rRNA-processing protein TSR1 homolog
10	9606.ENSP00000346886	0.944	GA-binding protein alpha chain
11	9606.ENSP00000232888	0.937	U3 small nucleolar RNA-interacting protein 2
12	9606.ENSP00000283109	0.936	Serine/threonine-protein kinase RIO2
13	9606.ENSP00000328854	0.929	Nucleolar complex protein 4 homolog
14	9606.ENSP00000296792	0.925	U3 small nucleolar RNA-associated protein 15 homolog
15	9606.ENSP00000358812	0.918	Protein RRP5 homolog
16	9606.ENSP00000308179	0.917	WD repeat-containing protein 3
17	9606.ENSP00000259239	0.916	U3 small nucleolar ribonucleoprotein protein IMP4
18	9606.ENSP00000309555	0.913	Host cell factor 1
19	9606.ENSP00000297579	0.901	DDB1- and CUL4-associated factor 13
20	9606.ENSP00000264279	0.900	Nucleolar protein 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034246	1.000	mitochondrial transcription factor activity
GO:0003723	1.000	RNA binding
GO:0005515	0.867	protein binding
GO:0003824	0.829	catalytic activity
GO:0016740	0.316	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0140053	0.990	mitochondrial gene expression
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0006352	0.983	DNA-templated transcription initiation
GO:0000959	0.966	mitochondrial RNA metabolic process
GO:0050789	0.467	regulation of biological process
GO:0050794	0.336	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0031981	0.974	nuclear lumen
GO:0005654	0.875	nucleoplasm
GO:0005759	0.858	mitochondrial matrix
GO:0009295	0.729	nucleoid
GO:0042645	0.602	mitochondrial nucleoid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.316	Transferases.

[back to server]