StarFunc result for job id Q9H611

User Input

>input (641 residues)
MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAP
GPAGRPRCFPLRAARLFTRFAEAGRSTLRLPAHDTPGAGAVQLLLSDCPPDRLRRFLRTL
RLKLAAAPGPGPASARAQLLGPRPRDFVTISPVQPEERRLRAATRVPDTTLVKRPVEPQA
GAEPSTEAPRWPLPVKRLSLPSTKPQLSEEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKR
ILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCVALAQRPGVRQGWLNC
QRLVIDEISMVEADLFDKLEAVARAVRQQNKPFGGIQLIICGDFLQLPPVTKGSQPPRFC
FQSKSWKRCVPVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGI
VATRLCTHQDDVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQ
VMLVKNLSVSRGLVNGARGVVVGFEAEGRGLPQVRFLCGVTEVIHADRWTVQATGGQLLS
RQQLPLQLAWAMSIHKSQGMTLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMA
VRCDPRVLHFYATLRRGRSLSLESPDDDEAASDQENMDPIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H611	1.000	1.000	0.000	641	1.000	1.000	Q9H611.pdb.gz	PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens OX=9606 GN=PIF1 PE=1 SV=2
2	AFDB:Q9VQR3	0.679	0.658	9.398E-78	663	0.445	0.430	Q9VQR3.pdb.gz	Q9VQR3_DROME ATP-dependent DNA helicase PIF1 OS=Drosophila melanogaster OX=7227 GN=Pif1 PE=2 SV=1
3	AFDB:Q38CE9	0.620	0.504	5.272E-54	796	0.307	0.247	Q38CE9.pdb.gz	PIF6_TRYB2 ATP-dependent DNA helicase PIF6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF6 PE=3 SV=1
4	AFDB:Q9UUA2	0.617	0.493	9.623E-49	805	0.307	0.245	Q9UUA2.pdb.gz	PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfh1 PE=1 SV=1
5	AFDB:P07271	0.607	0.456	2.104E-47	859	0.321	0.240	P07271.pdb.gz	PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIF1 PE=1 SV=2
6	AFDB:P38766	0.622	0.552	7.619E-46	723	0.284	0.252	P38766.pdb.gz	RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRM3 PE=1 SV=1
7	AFDB:Q57YG0	0.579	0.380	5.098E-43	992	0.295	0.191	Q57YG0.pdb.gz	PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF7 PE=3 SV=1
8	AFDB:Q580X6	0.624	0.437	5.083E-42	928	0.301	0.208	Q580X6.pdb.gz	PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF5 PE=1 SV=1
9	AFDB:Q384Y0	0.496	0.316	4.141E-30	1048	0.261	0.159	Q384Y0.pdb.gz	PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF2 PE=1 SV=1
10	AFDB:Q383A1	0.555	0.442	9.081E-30	812	0.211	0.166	Q383A1.pdb.gz	PIF3_TRYB2 ATP-dependent DNA helicase PIF3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF3 PE=3 SV=1
11	PDB:3upuA	0.337	0.469	6.574E-14	439	0.125	0.182	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
12	PDB:5ld2D	0.326	0.342	6.196E-13	605	0.147	0.155	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
13	PDB:5eanA	0.271	0.173	4.596E-7	1051	0.159	0.097	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
14	PDB:3k70D	0.259	0.296	9.500E-6	547	0.109	0.128	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
15	PDB:7zelA	0.286	0.227	1.862E-5	827	0.086	0.067	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
16	PDB:2is4B	0.217	0.220	1.002E-4	632	0.070	0.071	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
17	PDB:7d63RZ	0.197	0.157	2.077E-4	839	0.064	0.049	7d63RZ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
18	PDB:2is6A	0.214	0.210	2.749E-4	654	0.072	0.070	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
19	PDB:7mqaNS	0.178	0.132	3.441E-4	914	0.066	0.046	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6qi8D	0.161	0.311	3.639E-4	296	0.053	0.115	6qi8D.pdb.gz	Structural mechanism for regulation of the AAA-ATPases RUVBL1-RUVBL2 in the R2TP co-chaperone revealed by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H611	0.0	1282	641	1.000	1.000	PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens OX=9606 GN=PIF1 PE=1 SV=2
2	Q9VQR3	1.91e-175	516	663	0.446	0.431	Q9VQR3_DROME ATP-dependent DNA helicase PIF1 OS=Drosophila melanogaster OX=7227 GN=Pif1 PE=2 SV=1
3	Q9UUA2	1.96e-99	323	805	0.295	0.235	PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfh1 PE=1 SV=1
4	Q38CE9	7.27e-75	257	796	0.259	0.209	PIF6_TRYB2 ATP-dependent DNA helicase PIF6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF6 PE=3 SV=1
5	P07271	3.87e-71	248	859	0.212	0.158	PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIF1 PE=1 SV=2
6	Q57YG0	6.10e-71	249	992	0.268	0.173	PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF7 PE=3 SV=1
7	P38766	2.83e-69	241	723	0.206	0.183	RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRM3 PE=1 SV=1
8	Q580X6	1.97e-38	154	928	0.139	0.096	PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF5 PE=1 SV=1
9	Q383A1	1.96e-28	123	812	0.140	0.111	PIF3_TRYB2 ATP-dependent DNA helicase PIF3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF3 PE=3 SV=1
10	Q4QH47	1.38e-25	115	994	0.131	0.085	Q4QH47_LEIMA ATP-dependent DNA helicase OS=Leishmania major OX=5664 GN=LMJF_11_0330 PE=3 SV=1
11	Q384Y1	2.66e-25	114	929	0.128	0.088	PIF1_TRYB2 ATP-dependent DNA helicase PIF1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF1 PE=1 SV=1
12	Q381V6	1.05e-18	92.8	819	0.087	0.068	PIF4_TRYB2 ATP-dependent DNA helicase PIF4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF4 PE=3 SV=1
13	Q384Y0	1.05e-15	83.6	1048	0.117	0.072	PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF2 PE=1 SV=1
14	Q57VU6	8.94e-07	54.7	693	0.087	0.081	PIF8_TRYB2 ATP-dependent DNA helicase-like PIF8 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF8 PE=3 SV=1
15	Q9RT63	1.24e-05	50.8	715	0.173	0.155	RECDL_DEIRA ATP-dependent RecD-like DNA helicase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=recD2 PE=1 SV=1
16	P03214	0.012	41.2	809	0.044	0.035	HELI_EBVB9 DNA replication helicase OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=HELI PE=3 SV=1
17	P32270	0.20	37.0	439	0.087	0.128	DDA_BPT4 ATP-dependent DNA helicase dda OS=Enterobacteria phage T4 OX=10665 GN=dda PE=1 SV=2
18	A8VZX9	0.43	36.2	1769	0.115	0.042	A8VZX9_AGRRH Rcorf28 OS=Agrobacterium rhizogenes OX=359 PE=1 SV=1
19	A0A8I5ZUN3	0.83	35.4	35375	0.036	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
20	Q386I6	3.3	33.5	4658	0.059	0.008	Q386I6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0760 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	5.2	18.9	AAA ATPase domain
2	PF13245 AAA_19	0.013	27.2	AAA domain
3	PF13401 AAA_22	26	16.6	AAA domain
4	PF13479 AAA_24	16	16.7	AAA domain
5	PF13604 AAA_30	1.9e-17	75.2	AAA domain
6	PF12775 AAA_7	1.5e+02	13.3	P-loop containing dynein motor region
7	PF00005 ABC_tran	24	16.9	ABC transporter
8	PF09848 DUF2075	3.7e+02	11.7	Schlafen group 3, DNA/RNA helicase domain
9	PF02689 Herpes_Helicase	0.066	22.8	Helicase
10	PF01078 Mg_chelatase	70	14.2	Magnesium chelatase, subunit ChlI
11	PF01057 Parvo_NS1	7e+02	10.7	Parvovirus non-structural protein NS1
12	PF02562 PhoH	53	14.7	PhoH-like protein
13	PF05970 PIF1	1e-82	289.8	PIF1-like helicase
14	PF03193 RsgA_GTPase	11	17.4	RsgA GTPase
15	PF09273 Rubis-subs-bind	3.4e+02	13.3	Rubisco LSMT substrate-binding
16	PF13538 UvrD_C_2	2.4	19.4	UvrD-like helicase C-terminal domain
17	PF01443 Viral_helicase1	17	16.6	Viral (Superfamily 1) RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000012249

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000004420	0.922	Uncharacterized protein
2	9598.ENSPTRP00000034482	0.922	Uncharacterized protein
3	9598.ENSPTRP00000028637	0.915	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'- [...]
4	9598.ENSPTRP00000012754	0.909	Uncharacterized protein
5	9598.ENSPTRP00000003825	0.885	F-box protein, helicase, 18
6	9598.ENSPTRP00000041690	0.868	Uncharacterized protein
7	9598.ENSPTRP00000044957	0.850	Regulator of telomere elongation helicase 1
8	9598.ENSPTRP00000011825	0.837	DNA repair protein RAD51 homolog
9	9598.ENSPTRP00000022674	0.829	Proliferating cell nuclear antigen
10	9598.ENSPTRP00000042163	0.827	Timeless homolog
11	9598.ENSPTRP00000051017	0.806	Belongs to the PI3/PI4-kinase family.
12	9598.ENSPTRP00000024215	0.777	Cell division cycle 45 homolog
13	9598.ENSPTRP00000010694	0.770	Uncharacterized protein
14	9598.ENSPTRP00000006865	0.768	Immunoglobulin mu binding protein 2
15	9598.ENSPTRP00000037302	0.768	Polymerase (DNA directed), alpha 1, catalytic subunit
16	9598.ENSPTRP00000046426	0.754	DNA topoisomerase
17	9598.ENSPTRP00000043206	0.750	Uncharacterized protein
18	9598.ENSPTRP00000056956	0.750	Uncharacterized protein
19	9598.ENSPTRP00000031227	0.737	DNA helicase
20	9598.ENSPTRP00000006717	0.732	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140098	1.000	catalytic activity, acting on RNA
GO:0000287	1.000	magnesium ion binding
GO:0042162	1.000	telomeric DNA binding
GO:0005524	1.000	ATP binding
GO:0008186	0.999	ATP-dependent activity, acting on RNA
GO:0043139	0.999	5'-3' DNA helicase activity
GO:0017116	0.999	single-stranded DNA helicase activity
GO:0033677	0.912	DNA/RNA helicase activity
GO:0033678	0.856	5'-3' DNA/RNA helicase activity
GO:0005515	0.419	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.995	nucleic acid metabolic process
GO:0071897	0.990	DNA biosynthetic process
GO:0065009	0.989	regulation of molecular function
GO:0010556	0.989	regulation of macromolecule biosynthetic process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0051052	0.989	regulation of DNA metabolic process
GO:0048523	0.988	negative regulation of cellular process
GO:0000723	0.987	telomere maintenance
GO:0031324	0.979	negative regulation of cellular metabolic process
GO:0033044	0.978	regulation of chromosome organization
GO:0010605	0.978	negative regulation of macromolecule metabolic process
GO:0051172	0.975	negative regulation of nitrogen compound metabolic process
GO:0050790	0.974	regulation of catalytic activity
GO:0045934	0.972	negative regulation of nucleobase-containing compound metabolic process
GO:0006278	0.972	RNA-templated DNA biosynthetic process
GO:2000278	0.965	regulation of DNA biosynthetic process
GO:0032204	0.965	regulation of telomere maintenance
GO:1904356	0.962	regulation of telomere maintenance via telomere lengthening
GO:0010833	0.951	telomere maintenance via telomere lengthening
GO:2001251	0.916	negative regulation of chromosome organization
GO:0051053	0.912	negative regulation of DNA metabolic process
GO:0007004	0.910	telomere maintenance via telomerase
GO:0032210	0.895	regulation of telomere maintenance via telomerase
GO:0010558	0.889	negative regulation of macromolecule biosynthetic process
GO:0031327	0.887	negative regulation of cellular biosynthetic process
GO:0051972	0.886	regulation of telomerase activity
GO:2000279	0.828	negative regulation of DNA biosynthetic process
GO:0050896	0.708	response to stimulus
GO:0006974	0.658	cellular response to DNA damage stimulus
GO:0006281	0.631	DNA repair
GO:0048518	0.423	positive regulation of biological process
GO:0006260	0.400	DNA replication
GO:0048522	0.383	positive regulation of cellular process
GO:0006310	0.380	DNA recombination
GO:0006261	0.362	DNA-templated DNA replication
GO:0032205	0.339	negative regulation of telomere maintenance
GO:0006302	0.300	double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000781	0.997	chromosome, telomeric region
GO:0005737	0.906	cytoplasm
GO:0032991	0.511	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.999	DNA 5'-3' helicase.

[back to server]