StarFunc result for job id Q9H649

User Input

>input (340 residues)
MLTQLKAKSEGKLAKQICKVVLDHFEKQYSKELGDAWNTVREILTSPSCWQYAVLLNRFN
YPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAAS
LLPVLALELRDGEKVLDLCAAPGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIP
QPLINVIKVSELDGRKMGDAQPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQRRNLP
LLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMPMDIKGIARTCSH
DFTFAPTGQECGLLVIPDKGKAWGPMYVAKLKKSWSTGKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H649	1.000	1.000	9.852E-77	340	1.000	1.000	Q9H649.pdb.gz	NSUN3_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=NSUN3 PE=1 SV=1
2	AFDB:Q96CB9	0.846	0.753	2.475E-35	384	0.335	0.297	Q96CB9.pdb.gz	NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4 PE=1 SV=2
3	AFDB:Q9CZ57	0.855	0.766	6.208E-35	381	0.347	0.310	Q9CZ57.pdb.gz	NSUN4_MOUSE 5-methylcytosine rRNA methyltransferase NSUN4 OS=Mus musculus OX=10090 GN=Nsun4 PE=1 SV=1
4	PDB:7of5C	0.846	0.851	4.471E-34	338	0.326	0.328	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
5	AFDB:Q95XR2	0.819	0.607	1.523E-28	465	0.321	0.234	Q95XR2.pdb.gz	NSUN4_CAEEL 5-methylcytosine rRNA methyltransferase nsun-4 OS=Caenorhabditis elegans OX=6239 GN=nsun-4 PE=1 SV=1
6	PDB:7pd3x	0.842	0.785	3.307E-27	366	0.344	0.320	7pd3x.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
7	AFDB:Q381M3	0.700	0.710	1.489E-22	335	0.271	0.275	Q381M3.pdb.gz	Q381M3_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7280 PE=3 SV=1
8	AFDB:Q8VYM6	0.636	0.342	5.215E-21	671	0.247	0.125	Q8VYM6.pdb.gz	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
9	AFDB:Q9TYV5	0.632	0.344	6.267E-21	664	0.253	0.130	Q9TYV5.pdb.gz	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
10	AFDB:P76273	0.663	0.482	6.664E-21	479	0.235	0.167	P76273.pdb.gz	RSMF_ECOLI Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rsmF PE=1 SV=2
11	AFDB:Q9V106	0.661	0.717	8.516E-21	311	0.221	0.241	Q9V106.pdb.gz	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
12	AFDB:Q9FG73	0.646	0.340	9.626E-21	682	0.229	0.114	Q9FG73.pdb.gz	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
13	PDB:3a4tA	0.634	0.820	5.769E-20	258	0.215	0.283	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
14	PDB:2frxA	0.693	0.530	3.413E-19	455	0.232	0.174	2frxA.pdb.gz
15	PDB:1sqfA	0.656	0.535	3.964E-18	425	0.212	0.169	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
16	PDB:5zveB	0.649	0.581	4.215E-18	384	0.235	0.208	5zveB.pdb.gz	Archaeal NSUN6 catalyzes m5C72 modification on a wide-range of specific tRNAs.
17	PDB:7nacq	0.641	0.612	6.473E-18	358	0.212	0.201	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
18	PDB:5wwrA	0.638	0.487	6.832E-16	461	0.241	0.178	5wwrA.pdb.gz	Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6
19	PDB:3c0kA	0.407	0.356	5.711E-9	395	0.118	0.101	3c0kA.pdb.gz
20	PDB:7r6kq	0.413	0.744	2.339E-8	177	0.141	0.271	7r6kq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H649	0.0	703	340	1.000	1.000	NSUN3_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=NSUN3 PE=1 SV=1
2	Q9CZ57	1.64e-53	182	381	0.359	0.320	NSUN4_MOUSE 5-methylcytosine rRNA methyltransferase NSUN4 OS=Mus musculus OX=10090 GN=Nsun4 PE=1 SV=1
3	Q96CB9	3.48e-51	176	384	0.353	0.312	NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4 PE=1 SV=2
4	Q95XR2	1.36e-30	122	465	0.247	0.181	NSUN4_CAEEL 5-methylcytosine rRNA methyltransferase nsun-4 OS=Caenorhabditis elegans OX=6239 GN=nsun-4 PE=1 SV=1
5	Q381M3	9.41e-27	110	335	0.279	0.284	Q381M3_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7280 PE=3 SV=1
6	P76273	1.36e-23	103	479	0.188	0.134	RSMF_ECOLI Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rsmF PE=1 SV=2
7	Q9TYV5	4.89e-19	90.5	664	0.212	0.108	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
8	Q583H8	1.10e-18	89.0	525	0.182	0.118	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
9	Q9FG73	1.32e-17	86.3	682	0.209	0.104	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
10	O94268	5.44e-17	84.0	608	0.185	0.104	NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop2 PE=1 SV=1
11	Q8VYM6	6.53e-16	80.9	671	0.203	0.103	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
12	Q60343	1.49e-15	77.8	274	0.176	0.219	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1
13	Q922K7	1.81e-15	79.7	793	0.179	0.077	NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1
14	P40991	2.40e-15	79.3	618	0.182	0.100	NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP2 PE=1 SV=1
15	P46087	2.62e-15	79.3	812	0.185	0.078	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
16	Q9HGQ2	2.74e-14	76.3	688	0.209	0.103	TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4a PE=1 SV=3
17	Q9W4M9	3.17e-14	75.9	746	0.159	0.072	NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun2 PE=2 SV=1
18	Q9V106	3.54e-14	74.3	311	0.159	0.174	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
19	Q8TEA1	4.77e-14	75.1	469	0.162	0.117	NSUN6_HUMAN tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 OS=Homo sapiens OX=9606 GN=NSUN6 PE=1 SV=1
20	P38205	6.99e-14	74.7	684	0.176	0.088	NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	12	17.5	FtsJ-like methyltransferase
2	PF01189 Methyltr_RsmB-F	3.2e-28	110.3	16S rRNA methyltransferase RsmB/F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314441	0.895	tRNA (guanine-N(7)-)-methyltransferase
2	9606.ENSP00000309126	0.864	Probable 28S rRNA (cytosine-C(5))-methyltransferase
3	9606.ENSP00000396673	0.845	pre-rRNA processing protein FTSJ3
4	9606.ENSP00000402038	0.842	Protein MTO1 homolog, mitochondrial
5	9606.ENSP00000238146	0.831	ATP-dependent RNA helicase DDX55
6	9606.ENSP00000371201	0.821	Putative methyltransferase NSUN7
7	9606.ENSP00000333934	0.815	tRNA (guanine(10)-N2)-methyltransferase homolog
8	9606.ENSP00000365837	0.792	tRNA pseudouridine synthase A
9	9606.ENSP00000354040	0.777	Nucleolar GTP-binding protein 1
10	9606.ENSP00000261015	0.771	Ribosome biogenesis protein WDR12
11	9606.ENSP00000203001	0.765	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
12	9606.ENSP00000261249	0.764	tRNA (guanine(37)-N1)-methyltransferase
13	9606.ENSP00000366396	0.762	5'-3' exoribonuclease 2
14	9606.ENSP00000346725	0.757	Pescadillo homolog
15	9606.ENSP00000358812	0.755	Protein RRP5 homolog
16	9606.ENSP00000460871	0.754	Ribosomal L1 domain-containing protein 1
17	9606.ENSP00000360412	0.753	Nucleolar complex protein 3 homolog
18	9606.ENSP00000455106	0.747	Ribosome biogenesis protein BOP1
19	9606.ENSP00000216489	0.746	Nucleic acid dioxygenase ALKBH1
20	9606.ENSP00000367030	0.742	tRNA (cytosine(38)-C(5))-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016427	0.999	tRNA (cytosine) methyltransferase activity
GO:0005488	0.991	binding
GO:0016428	0.942	tRNA (cytosine-5-)-methyltransferase activity
GO:0003723	0.830	RNA binding
GO:0005515	0.666	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016070	0.996	RNA metabolic process
GO:0051246	0.995	regulation of protein metabolic process
GO:0034660	0.985	ncRNA metabolic process
GO:0009451	0.985	RNA modification
GO:0006396	0.985	RNA processing
GO:0006399	0.982	tRNA metabolic process
GO:0034470	0.981	ncRNA processing
GO:0001510	0.978	RNA methylation
GO:0008033	0.973	tRNA processing
GO:0050794	0.954	regulation of cellular process
GO:0006400	0.953	tRNA modification
GO:0031326	0.862	regulation of cellular biosynthetic process
GO:0010556	0.858	regulation of macromolecule biosynthetic process
GO:0010468	0.853	regulation of gene expression
GO:0030488	0.804	tRNA methylation
GO:0002097	0.796	tRNA wobble base modification
GO:0010608	0.725	post-transcriptional regulation of gene expression
GO:0062125	0.714	regulation of mitochondrial gene expression
GO:0070129	0.665	regulation of mitochondrial translation
GO:0071840	0.358	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005759	0.978	mitochondrial matrix
GO:0031981	0.966	nuclear lumen
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0005730	0.766	nucleolus
GO:0005654	0.410	nucleoplasm
GO:0032991	0.321	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.

[back to server]