StarFunc result for job id Q9H694

User Input

>input (974 residues)
MAAQGEPGYLAAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEA
MLQAAAEGKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKE
MIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKS
NQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVS
FKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMM
GRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDM
KEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESS
GVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSTTPNSLLNALNS
SVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTYGH
TAPSPPPGLTPVDVHINSMQTEGKKISAALNGHAQSPDIKYGAISTSSLGEKVLSANHGD
PSIQTSGSEQTSPKSSPTEGCNDAFVEVGMPRSPSHSGNAGDLKQMMCPSKVSCAKRQTV
ELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPR
SSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANH
VSYKPTMTTTYEGSSMSLSRSNSREHLGGGSESDNWRDRNGIGPGSHSEFAASIGSPKRK
QNKSTEHYLSSSNYMDCISSLTGSNGCNLNSSFKGSDLPELFSKLGLGKYTDVFQQQEID
LQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFESPNARTSFLEGGASGRLP
RQYHSDIASVSGRW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99MQ1	0.605	0.603	0.000	977	0.931	0.928	Q99MQ1.pdb.gz	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
2	PDB:7mqaSW	0.091	0.314	3.837E-4	195	0.024	0.118	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	PDB:6ke6RC	0.079	0.205	6.936E-4	278	0.022	0.076	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
4	PDB:7mq8NY	0.069	0.187	2.137E-3	274	0.034	0.120	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	AFDB:A0A1D9BZF0	0.036	0.061	2.584E-3	507	0.074	0.142	A0A1D9BZF0.pdb.gz	GCNA_MOUSE Germ cell nuclear acidic protein OS=Mus musculus OX=10090 GN=Gcna PE=1 SV=1
6	PDB:6zqbJO	0.074	0.225	3.048E-3	236	0.028	0.114	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
7	PDB:5wq8A	0.108	0.188	3.641E-3	496	0.035	0.069	5wq8A.pdb.gz
8	PDB:7ajuJJ	0.087	0.290	3.863E-3	199	0.018	0.090	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
9	PDB:1msvB	0.063	0.161	4.614E-3	320	0.033	0.100	1msvB.pdb.gz
10	PDB:7nshBC	0.064	0.082	4.614E-3	700	0.037	0.051	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
11	AFDB:A0A0A0MQZ8	0.070	0.078	7.501E-3	866	0.113	0.127	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
12	AFDB:B7SBD2	0.042	0.067	7.501E-3	577	0.088	0.149	B7SBD2.pdb.gz	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
13	PDB:6vlzv	0.063	0.079	9.389E-3	712	0.026	0.035	6vlzv.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
14	PDB:7cdwA	0.077	0.098	9.389E-3	683	0.023	0.032	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.
15	AFDB:O43426	0.048	0.032	1.278E-2	1573	0.125	0.078	O43426.pdb.gz	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
16	AFDB:A0A0G2K916	0.071	0.033	1.356E-2	2615	0.116	0.043	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
17	AFDB:O75179	0.067	0.028	1.356E-2	2603	0.114	0.043	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
18	AFDB:A0A087X1T2	0.047	0.058	1.527E-2	654	0.088	0.131	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
19	AFDB:E9QEX9	0.068	0.027	1.935E-2	2607	0.097	0.036	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
20	AFDB:P42283	0.049	0.053	2.311E-2	891	0.098	0.107	P42283.pdb.gz	LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99MQ1	0.0	1748	977	0.931	0.928	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
2	Q9H694	0.0	2008	974	1.000	1.000	BICC1_HUMAN Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1 PE=1 SV=2
3	Q24009	7.86e-103	344	905	0.174	0.187	BICC_DROME Protein bicaudal C OS=Drosophila melanogaster OX=7227 GN=BicC PE=1 SV=2
4	Q68DC2	2.15e-12	73.6	871	0.042	0.047	ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKS6 PE=1 SV=2
5	Q5XJ13	3.05e-12	73.2	739	0.043	0.057	ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio OX=7955 GN=anks6 PE=2 SV=1
6	Q9CZK6	3.34e-12	72.8	655	0.043	0.064	ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Anks3 PE=1 SV=2
7	Q6GQX6	3.93e-12	72.8	883	0.041	0.045	ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Anks6 PE=1 SV=2
8	P0C0T2	4.47e-12	72.8	885	0.041	0.045	ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Anks6 PE=1 SV=2
9	Q00341	7.68e-12	72.0	1268	0.074	0.057	VIGLN_HUMAN Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2
10	A0A024R4E5	8.09e-12	72.0	1268	0.074	0.057	A0A024R4E5_HUMAN High density lipoprotein binding protein OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=1
11	Q6ZW76	2.05e-11	70.5	656	0.032	0.047	ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ANKS3 PE=1 SV=1
12	A0A8I6AP00	1.58e-10	65.9	331	0.081	0.239	A0A8I6AP00_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=4 SV=1
13	Q7ZU44	5.66e-10	65.9	1208	0.082	0.066	Q7ZU44_DANRE High density lipoprotein-binding protein (Vigilin) OS=Danio rerio OX=7955 GN=hdlbp PE=1 SV=1
14	Q9U982	7.32e-10	65.9	1301	0.049	0.037	Q9U982_DROME Drosophila dodeca-satellite protein 1 OS=Drosophila melanogaster OX=7227 GN=Dp1 PE=2 SV=1
15	Q7KN75	7.51e-10	65.9	1301	0.049	0.037	Q7KN75_DROME Dodeca-satellite-binding protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Dp1 PE=1 SV=1
16	Q7KN84	1.36e-09	64.7	897	0.075	0.081	Q7KN84_DROME K Homology domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Dp1 PE=2 SV=1
17	A0A8I5ZZC0	5.08e-09	61.2	316	0.082	0.253	A0A8I5ZZC0_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
18	A0A0G2KBC5	5.42e-09	61.2	338	0.074	0.213	A0A0G2KBC5_RAT Poly(rC) binding protein 2 OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
19	Q4V8F6	7.21e-09	60.8	335	0.081	0.236	Q4V8F6_RAT Pcbp2 protein OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1
20	O59810	1.14e-08	61.6	1291	0.063	0.047	VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vgl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09597 IGR	5.6e+02	12.1	IGR protein motif
2	PF00013 KH_1	3.4e-35	131.0	KH domain
3	PF17905 KH_10	0.03	26.1	GLD-3 KH domain 5
4	PF07650 KH_2	4.4	18.5	KH domain
5	PF00536 SAM_1	8.1e-11	53.5	SAM domain (Sterile alpha motif)
6	PF07647 SAM_2	1.6e-07	42.7	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362993

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478754	0.879	Probable ATP-dependent RNA helicase DDX6
2	9606.ENSP00000351159	0.868	CCR4-NOT transcription complex subunit 3
3	9606.ENSP00000279068	0.809	Protein LSM14 homolog B
4	9606.ENSP00000446271	0.809	Protein LSM14 homolog A
5	9606.ENSP00000397563	0.775	Poly(A) RNA polymerase GLD2
6	9606.ENSP00000321179	0.716	RNA-binding protein 44
7	9606.ENSP00000391723	0.701	Pumilio homolog 1
8	9606.ENSP00000268616	0.682	Zinc finger CCHC domain-containing protein 14
9	9606.ENSP00000358814	0.676	S-adenosylhomocysteine hydrolase-like protein 1
10	9606.ENSP00000453854	0.660	Selenocysteine insertion sequence-binding protein 2-like
11	9606.ENSP00000341344	0.652	ADP-ribosylation factor-binding protein GGA1
12	9606.ENSP00000229268	0.636	Ubiquitin carboxyl-terminal hydrolase 5
13	9606.ENSP00000269499	0.614	Zinc finger CCHC-type containing 2
14	9606.ENSP00000384886	0.607	Gamma-interferon-inducible lysosomal thiol reductase
15	9606.ENSP00000384490	0.602	Chromobox protein homolog 6
16	9606.ENSP00000255324	0.601	RING finger protein 17
17	9606.ENSP00000326550	0.595	Transforming acidic coiled-coil-containing protein 3
18	9606.ENSP00000338173	0.593	Pumilio homolog 2
19	9606.ENSP00000016171	0.583	Cytochrome c oxidase assembly protein COX15 homolog
20	9606.ENSP00000384193	0.582	Cell adhesion molecule 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.985	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.975	negative regulation of biological process
GO:0048523	0.965	negative regulation of cellular process
GO:0048583	0.962	regulation of response to stimulus
GO:0023051	0.858	regulation of signaling
GO:0010646	0.858	regulation of cell communication
GO:0009966	0.849	regulation of signal transduction
GO:0030111	0.782	regulation of Wnt signaling pathway
GO:0009987	0.723	cellular process
GO:0023057	0.628	negative regulation of signaling
GO:0010648	0.628	negative regulation of cell communication
GO:0048585	0.616	negative regulation of response to stimulus
GO:0032501	0.477	multicellular organismal process
GO:0009968	0.453	negative regulation of signal transduction
GO:0032502	0.452	developmental process
GO:0048856	0.371	anatomical structure development
GO:0019222	0.332	regulation of metabolic process
GO:0007275	0.329	multicellular organism development
GO:0051171	0.318	regulation of nitrogen compound metabolic process
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0060828	0.312	regulation of canonical Wnt signaling pathway
GO:0048518	0.309	positive regulation of biological process
GO:0031323	0.306	regulation of cellular metabolic process
GO:0080090	0.301	regulation of primary metabolic process
GO:0030178	0.301	negative regulation of Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.998	cytosol
GO:0043227	0.972	membrane-bounded organelle
GO:0005634	0.949	nucleus
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0032991	0.872	protein-containing complex
GO:0031981	0.385	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]