StarFunc result for job id Q9H6A9

User Input

>input (2034 residues)
MGSQVLQILRQGVWASLTGGWFFDPHQSTFSNCFHLYVWIFLLIFPFLLYMVLPPSLMVA
GVYCLVVAVIFATIKTVNYRLHAMFDQGEIVEKRSSTMGELEEEPAQGDSNPPRDPGVEM
TVFRKVSSTPPVRCSSQHSVFGFNQVSELLPRMEDSGPLRDIKELVREQGSNNVIVTSAD
REMLKLSSQEKLIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPL
LKGSLSQELSKSFLTLTQPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDS
CFSGTDRETLSSFKSEKTNSTHLDSPPGGPAPEGSDTDPPSEAELPASPDAGVPSDDTLR
SFDTVIGAGTPPGLAEPLLVVRPKDLALLRPSKRQPPLRRHSPPGRAPRRPLLEGGGFFE
DEDTSEGSELSPASSLRSQRRYSTDSSSSTSCYSPESSRGAAGGPRKRRAPHGAEEGTAV
PPKRPYGTQRTPSTASAKTHARVLSMDGAGGDVLRPPLAGCKAELEAQVGVEQAASEPVV
LPAEARRGPAANQPGWRGELQEEGAVGGAAEETGRRDRSSSVRRTQAIRRRHNAGSNPTP
PASVMGSPPSSLQEAQRGRAASHSRALTLPSALHFASSLLLTRAGANVHEACTFDDTSEG
AVHYFYDESGVRRSYTFGLAGGGYENPVGQQGEQTANGAWDRHSHSSSFHSADVPEATGG
LNLLQPRPVVLQGMQVRRVPLEIPEEQTLMEEAPPRAQHSYKYWLLPGRWTSVRYERLAL
LALLDRTRGVLENIFGVGLSSLVAFLGYLLLLKGFFTDIWVFQFCLVIASCQYSLLKSVQ
PDAASPMHGHNWVIAYSRPVYFCICCLLIWLLDALGSAQPFPPVSLYGLTLFSASFFFCA
RDVATVFTLCFPFVFLLGLLPQVNTCLMYLLEQIDMHGFGGTAATSPLTAVFSLSRSLLA
AALLYGFCLGAIKTPWPEQHVPVLFSVFCGLLVALSYHLSRQSSDPTVLWSLIRSKLFPE
LEERSLETARAEPPDPLPDKMRQSVREVLHSDLVMCVVIAVLTFAISASTVFIALKSVLG
FVLYALAGAVGFFTHYLLPQLRKQLPWFCLSQPVLKPLEYSQYEVRGAAQVMWFEKLYAG
LQCVEKYLIYPAVVLNALTVDAHTVVSHPDKYCFYCRALLMTVAGLKLLRSAFCCPPQQY
LTLAFTVLLFHFDYPRLSQGFLLDYFLMSLLCSKLWDLLYKLRFVLTYIAPWQITWGSAF
HAFAQPFAVPHSAMLFVQALLSGLFSTPLNPLLGSAVFIMSYARPLKFWERDYNTKRVDH
SNTRLVTQLDRNPGADDNNLNSIFYEHLTRSLQHTLCGDLVLGRWGNYGPGDCFVLASDY
LNALVHLIEVGNGLVTFQLRGLEFRGTYCQQREVEAITEGVEEDEGCCCCEPGHLPRVLS
FNAAFGQRWLAWEVTASKYVLEGYSISDNNAASMLQVFDLRKILITYYVKSIIYYVSRSP
KLEVWLSHEGITAALRPVRVPGYADSDPTFSLSVDEDYDLRLSGLSLPSFCAVHLEWIQY
CASRRSQPVDQDWNSPLVTLCFGLCVLGRRALGTASHSMSASLEPFLYGLHALFKGDFRI
TSPRDEWVFADMDLLHRVVAPGVRMALKLHQDHFTSPDEYEEPAALYDAIAANEERLVIS
HEGDPAWRSAILSNTPSLLALRHVLDDASDEYKIIMLNRRHLSFRVIKVNRECVRGLWAG
QQQELVFLRNRNPERGSIQNAKQALRNMINSSCDQPLGYPIYVSPLTTSLAGSHPQLRAL
WGGPISLGAIAHWLLRTWERLHKGCGAGCNSGGNVDDSDCSGGGGLTSLSNNPPVAHPTP
ENTAGNGDQPLPPGPGWGPRSSLSGSGDGRPPPLLQWPPPRLPGPPPASPIPTEGPRTSR
PPGPGLLSSEGPSGKWSLGGRKGLGGSDGEPASGSPKGGTPKSQAPLDLSLSLSLSLSPD
VSTEASPPRASQDIPCLDSSAPESGTPMGALGDWPAPIEERESPAAQPLLEHQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NKB5	0.584	0.557	0.000	2137	0.446	0.424	A6NKB5.pdb.gz	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	AFDB:Q7Z5K2	0.052	0.072	2.410E-1	1190	0.075	0.128	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
3	AFDB:Q9W517	0.040	0.040	5.011E-1	1741	0.085	0.099	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
4	PDB:7qpgB	0.036	0.093	1.051	591	0.024	0.083	7qpgB.pdb.gz
5	AFDB:Q24270	0.063	0.056	1.177	2516	0.148	0.120	Q24270.pdb.gz	CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2
6	PDB:7tzcA	0.050	0.033	1.289	4404	0.057	0.026	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
7	PDB:6s4mA	0.048	0.134	1.516	426	0.029	0.138	6s4mA.pdb.gz
8	PDB:6bcuA	0.057	0.057	1.713	2204	0.059	0.055	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
9	PDB:7r5jB0	0.060	0.064	1.784	1748	0.059	0.068	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
10	PDB:5utmA	0.020	0.099	1.935	345	0.006	0.035	5utmA.pdb.gz	Mutant Structures of Streptococcus agalactiae GAPDH
11	AFDB:Q5H9R4	0.046	0.043	2.080	2290	0.080	0.071	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
12	PDB:7c5oO	0.025	0.112	2.099	338	0.005	0.033	7c5oO.pdb.gz	Novel Structures of Type 1 Glyceraldehyde-3-phosphate Dehydrogenase from Escherichia coli Provide New Insights into the Mechanism of Generation of 1,3-Bisphosphoglyceric Acid.
13	PDB:6e8eA	0.022	0.074	2.372	468	0.007	0.032	6e8eA.pdb.gz
14	PDB:3axjB	0.033	0.142	2.573	240	0.012	0.100	3axjB.pdb.gz
15	PDB:5jyfB	0.021	0.116	2.679	294	0.005	0.034	5jyfB.pdb.gz
16	AFDB:F4HTH8	0.038	0.044	3.988	1181	0.061	0.105	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
17	AFDB:E5FYH1	0.047	0.055	4.692	1653	0.093	0.115	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
18	AFDB:A6YIH7	0.035	0.058	5.989	970	0.068	0.143	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
19	AFDB:Q8IIK5	0.050	0.066	5.989	1201	0.066	0.112	Q8IIK5.pdb.gz	Q8IIK5_PLAF7 Rhoptry neck protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116000 PE=4 SV=2
20	AFDB:Q6S7F2	0.026	0.047	6.237	904	0.050	0.112	Q6S7F2.pdb.gz	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NKB5	0.0	1564	2137	0.444	0.423	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	P18490	0.0	694	3413	0.151	0.090	PCX_DROME Protein pecanex OS=Drosophila melanogaster OX=7227 GN=pcx PE=2 SV=4
3	Q63HM2	4.44e-11	70.9	1172	0.025	0.044	PCX4_HUMAN Pecanex-like protein 4 OS=Homo sapiens OX=9606 GN=PCNX4 PE=1 SV=4
4	Q8T6L9	1.2	36.6	1313	0.020	0.031	Q8T6L9_DROME Unconventional myosin 29D OS=Drosophila melanogaster OX=7227 GN=dachs PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05041 Pecanex_C	1.3e-112	386.4	Pecanex protein (C-terminus)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347931

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290607	0.614	StAR-related lipid transfer protein 9
2	9606.ENSP00000475489	0.578	M-phase phosphoprotein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0065007	0.690	biological regulation
GO:0050789	0.616	regulation of biological process
GO:0008152	0.571	metabolic process
GO:0050794	0.511	regulation of cellular process
GO:0044237	0.465	cellular metabolic process
GO:0071704	0.389	organic substance metabolic process
GO:0050896	0.382	response to stimulus
GO:0006807	0.358	nitrogen compound metabolic process
GO:0016043	0.350	cellular component organization
GO:0044238	0.326	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0005783	0.872	endoplasmic reticulum
GO:0016020	0.815	membrane
GO:0043232	0.392	intracellular non-membrane-bounded organelle
GO:0032991	0.349	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]