StarFunc result for job id Q9H6K1

User Input

>input (298 residues)
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGG
DQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISK
NTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCW2	0.627	0.627	3.107E-52	298	1.000	1.000	A0A024RCW2.pdb.gz
2	AFDB:Q55CE3	0.367	0.172	2.730E-17	646	0.195	0.090	Q55CE3.pdb.gz	Q55CE3_DICDI ZZ-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270098 PE=4 SV=1
3	AFDB:Q9SB64	0.355	0.152	2.218E-14	704	0.181	0.077	Q9SB64.pdb.gz	NBR1_ARATH Protein NBR1 homolog OS=Arabidopsis thaliana OX=3702 GN=NBR1 PE=1 SV=1
4	AFDB:M1BJF6	0.364	0.129	4.035E-14	862	0.168	0.058	M1BJF6.pdb.gz	JOKA2_SOLTU Protein JOKA2 OS=Solanum tuberosum OX=4113 GN=JOKA2 PE=1 SV=1
5	AFDB:A0A024R1V3	0.356	0.116	3.085E-13	966	0.201	0.062	A0A024R1V3.pdb.gz
6	PDB:7vqoA	0.330	0.085	1.640E-10	1180	0.124	0.031	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
7	AFDB:P34082	0.196	0.080	5.637E-5	873	0.114	0.039	P34082.pdb.gz	FAS2_DROME Fasciclin-2 OS=Drosophila melanogaster OX=7227 GN=Fas2 PE=1 SV=1
8	AFDB:A8Y5W0	0.175	0.079	1.302E-4	810	0.107	0.040	A8Y5W0.pdb.gz	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
9	PDB:7tvzE	0.283	0.134	1.461E-4	665	0.047	0.021	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
10	AFDB:Q96PJ5	0.213	0.138	2.231E-4	515	0.121	0.070	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
11	PDB:6xt9A	0.260	0.148	2.820E-4	567	0.084	0.044	6xt9A.pdb.gz
12	AFDB:Q99062	0.159	0.073	2.835E-4	836	0.097	0.035	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
13	AFDB:Q70AK3	0.176	0.096	3.195E-4	648	0.087	0.040	Q70AK3.pdb.gz	FLRT3_XENLA Leucine-rich repeat transmembrane protein FLRT3 OS=Xenopus laevis OX=8355 GN=flrt3 PE=1 SV=2
14	PDB:6kzbC	0.244	0.125	4.038E-4	649	0.060	0.028	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
15	PDB:2hkaB	0.207	0.420	4.287E-4	130	0.017	0.038	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
16	PDB:5jp0A	0.202	0.095	6.138E-4	745	0.057	0.023	5jp0A.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
17	PDB:4f38B	0.253	0.362	7.345E-4	192	0.057	0.089	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
18	PDB:1rowA	0.229	0.513	8.278E-4	107	0.044	0.121	1rowA.pdb.gz
19	PDB:3es6B	0.266	0.589	8.789E-4	118	0.044	0.110	3es6B.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
20	PDB:4lk4A	0.195	0.181	1.185E-3	326	0.060	0.055	4lk4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H6K1	0.0	620	298	1.000	1.000	ILRUN_HUMAN Protein ILRUN OS=Homo sapiens OX=9606 GN=ILRUN PE=1 SV=2
2	Q5TH58	3.41e-168	467	224	0.752	1.000	Q5TH58_HUMAN Inflammation and lipid regulator with UBA-like and NBR1-like domains OS=Homo sapiens OX=9606 GN=ILRUN PE=1 SV=1
3	Q55CE3	6.68e-19	89.0	646	0.124	0.057	Q55CE3_DICDI ZZ-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270098 PE=4 SV=1
4	M1BJF6	1.09e-14	76.6	862	0.128	0.044	JOKA2_SOLTU Protein JOKA2 OS=Solanum tuberosum OX=4113 GN=JOKA2 PE=1 SV=1
5	Q9SB64	4.52e-14	74.7	704	0.128	0.054	NBR1_ARATH Protein NBR1 homolog OS=Arabidopsis thaliana OX=3702 GN=NBR1 PE=1 SV=1
6	Q14596	1.69e-07	54.7	966	0.107	0.033	NBR1_HUMAN Next to BRCA1 gene 1 protein OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=3
7	B7Z5R6	1.89e-07	54.7	837	0.107	0.038	B7Z5R6_HUMAN NBR1 autophagy cargo receptor OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=1
8	P97432	2.00e-07	54.7	988	0.111	0.033	NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus OX=10090 GN=Nbr1 PE=1 SV=1
9	Q9P792	0.005	40.4	397	0.081	0.060	YN8B_SCHPO ZZ-type zinc finger-containing protein P35G2.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.11c PE=1 SV=1
10	A0JMB7	1.9	32.7	917	0.064	0.021	A0JMB7_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:152772 PE=2 SV=1
11	C8VG90	5.9	31.2	783	0.077	0.029	ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=acoA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16158 N_BRCA1_IG	7.6e-28	108.5	Ig-like domain from next to BRCA1 gene
2	PF14555 UBA_4	4.6e-07	40.9	UBA-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010356362.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010350854.1	0.719	Mindbomb E3 ubiquitin protein ligase 2
2	61622.XP_010353180.1	0.719	E3 ubiquitin-protein ligase MIB1
3	61622.XP_010379269.1	0.712	Sequestosome 1
4	61622.XP_010387962.1	0.691	Armadillo repeat-containing protein 12 isoform X1
5	61622.XP_010376465.1	0.668	ubiquitin-40S ribosomal protein S27a
6	61622.XP_010376974.1	0.656	Peroxisomal biogenesis factor 5 like
7	61622.XP_010386339.1	0.656	Peroxisomal biogenesis factor 5
8	61622.XP_010375502.1	0.652	NBR1, autophagy cargo receptor
9	61622.XP_010356369.1	0.638	Protein kinase C and casein kinase substrate in neurons protein 1 isoform X1
10	61622.XP_010387972.1	0.636	Solute carrier family 26 member 8
11	61622.XP_010353959.1	0.604	Microtubule-associated proteins 1A/1B light chain 3B
12	61622.XP_010365823.1	0.604	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 716 ESTs, 17 Proteins, and 86% coverage of the annotated genomic feature by RNAseq alignments
13	61622.XP_010366898.1	0.604	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
14	61622.XP_010369670.1	0.604	Gamma-aminobutyric acid receptor-associated protein-like 1
15	61622.XP_010370554.1	0.604	Gamma-aminobutyric acid receptor-associated protein
16	61622.XP_010375633.1	0.604	Gamma-aminobutyric acid receptor-associated protein
17	61622.XP_010381285.1	0.604	GABA type A receptor associated protein like 2
18	61622.XP_010382367.1	0.604	Uncharacterized protein LOC104678726
19	61622.XP_010383009.1	0.604	Microtubule-associated proteins 1A/1B light chain 3C
20	61622.XP_010383101.1	0.604	Gamma-aminobutyric acid receptor-associated protein-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.987	regulation of cellular process
GO:0051098	0.979	regulation of binding
GO:0002831	0.975	regulation of response to biotic stimulus
GO:0031347	0.973	regulation of defense response
GO:0001817	0.971	regulation of cytokine production
GO:0032101	0.968	regulation of response to external stimulus
GO:0001818	0.964	negative regulation of cytokine production
GO:0031348	0.961	negative regulation of defense response
GO:1903828	0.961	negative regulation of protein localization
GO:0050688	0.960	regulation of defense response to virus
GO:1903555	0.958	regulation of tumor necrosis factor superfamily cytokine production
GO:0032479	0.956	regulation of type I interferon production
GO:1900180	0.955	regulation of protein localization to nucleus
GO:0032102	0.954	negative regulation of response to external stimulus
GO:0051100	0.947	negative regulation of binding
GO:0002832	0.946	negative regulation of response to biotic stimulus
GO:0032480	0.937	negative regulation of type I interferon production
GO:0051101	0.921	regulation of DNA binding
GO:1903556	0.917	negative regulation of tumor necrosis factor superfamily cytokine production
GO:1900181	0.904	negative regulation of protein localization to nucleus
GO:0032680	0.902	regulation of tumor necrosis factor production
GO:0050687	0.896	negative regulation of defense response to virus
GO:0043392	0.875	negative regulation of DNA binding
GO:0032720	0.875	negative regulation of tumor necrosis factor production
GO:0009987	0.744	cellular process
GO:0008152	0.482	metabolic process
GO:0071704	0.412	organic substance metabolic process
GO:0044238	0.389	primary metabolic process
GO:0044237	0.343	cellular metabolic process
GO:0006807	0.319	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0016607	1.000	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]