StarFunc result for job id Q9H6K5

User Input

>input (1346 residues)
MDNKRDKAKAGAAARTPAARAPGLLTPRPPGSPRPPPPVTPAALRVLGAAGAVGRKPLAE
RAGGIGGATIPESAPRAGPTRSAGTSSRNPASRPPASGRGERAPPAKNTSPGPVSSPGRA
SGTTRPGPLGQKGLRISAEETVARGKATEAPKRSALSAGARRDTSGPTPGTPSPAMARRS
RAAGTEVGLPRPAPSARPRPPTEGPRKSVSSASEHSTTEPSPAARRRPSAGGGLQRPASR
SLSSSATPLSSPARSGPSARGTPRAPAHPSQPKPKGLQALRPPQVTPPRKDAAPALGPLS
SSPLATPSPSGTKARPVPPPDNAATPLPATLPPSPPVTPPPPAALQSQAPPTLPATPHSS
SLTCQLATPLPLAPPSPSAPPSLQTLPSPPATPPSQVPPTQLIMSFPEAGVSSLATAAFV
ASVSPSVSSPLQSMPPTQANPALPSLPTLLSPLATPPLSAMSPLQGPVSPATSLGNSAFP
LAALPQPGLSALTTPPPQASPSPSPPSLQATPHTLATLPLQDSPLLATLPLQASPSPLTT
VSLQDPPLVSPSLLASPPLQAPPHPQAPPSMTTPPMQAPPSLQTIPPIQVPHSLTSPSLQ
APPSPLALSSLQATTSLGSPTLQATHSFLTMSPRQTQASLISPSRPASTPPDSPPLQAPL
SLPASPPLQTSLSPAVSPLSSPLTIHPLQALSSLASHSPQAPLSSLIMPPLETQSSLAPP
SLQTPPASLTTPPLENLPSLAPPPLQTASAPLTTPPLENLPSLAPPPLQTASAPLTTPHL
ETPPCPAPCPLQAPPSPLTTPPPETPSSIATPPPQAPPALASPPLQGLPSPPLSPLATPP
PQAPPALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQAPFSPPPSPPVQAPFS
PPASPPVSPSATPPSQAPPSLAAPPLQVPPSPPASPPMSPSATPPPQAPPPLAAPPLQVP
PSPPASPPMSPSATPPPRVPPLLAAPPLQVPPSPPASLPMSPLAKPPPQAPPALATPPLQ
ALPSPPASFPGQAPFSPSASLPMSPLATPPPQAPPVLAAPLLQVPPSPPASPTLQAPRRP
PTPGPDTSVSGPRLTLALAPGPPPPPSRSPSSTLSGPDLAGHSSSATSTPEELRGYDSGP
EGGAAASPPPDAELAACHPAAWSRGPAPPLAFRGAPGAPLPWPPATGPGSADGLCTIYET
EGPESATPAPGALDPGPSPGTSGGKAAAGAGAGASSRSPKQARLGELPLGALQASVVQHL
LSRTLLLAAAEGAAGGSGGGPGGAEGGGVTGGARAALSDAELGRWAELLSPLDESRASIT
SVTSFSPDDVASPQGDWTVVEVETFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07563	0.035	0.033	3.010E-6	1470	0.205	0.188	Q07563.pdb.gz	COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus OX=10090 GN=Col17a1 PE=1 SV=3
2	AFDB:D4A0X3	0.031	0.033	8.045E-5	1237	0.175	0.191	D4A0X3.pdb.gz	BTBD8_RAT BTB/POZ domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Btbd8 PE=1 SV=4
3	AFDB:O14029	0.041	0.032	3.276E-3	1995	0.151	0.102	O14029.pdb.gz	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
4	AFDB:E9Q4F7	0.042	0.025	4.992E-3	2643	0.189	0.096	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
5	AFDB:P51611	0.040	0.031	7.608E-3	2090	0.198	0.128	P51611.pdb.gz	HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus OX=10036 GN=HCFC1 PE=1 SV=1
6	AFDB:Q9Z0Y7	0.027	0.029	7.608E-3	1216	0.117	0.129	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
7	AFDB:P29617	0.036	0.030	1.066E-2	1703	0.163	0.129	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
8	AFDB:Q9NYV4	0.038	0.035	1.159E-2	1490	0.104	0.094	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
9	AFDB:Q9VHC2	0.033	0.036	1.493E-2	1173	0.120	0.138	Q9VHC2.pdb.gz	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
10	AFDB:Q8NEY1	0.034	0.029	1.767E-2	1877	0.199	0.143	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
11	PDB:6h2vA	0.024	0.089	2.637	210	0.004	0.029	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
12	PDB:5m5wA	0.022	0.020	3.694	1493	0.008	0.007	5m5wA.pdb.gz	Molecular Structures of Transcribing RNA Polymerase I.
13	PDB:1tuvA	0.027	0.173	4.371	103	0.005	0.068	1tuvA.pdb.gz	Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
14	PDB:1sceC	0.025	0.188	4.756	111	0.007	0.081	1sceC.pdb.gz
15	PDB:2g3aA	0.030	0.177	5.174	137	0.007	0.073	2g3aA.pdb.gz
16	PDB:2dhmA	0.025	0.202	5.628	107	0.006	0.075	2dhmA.pdb.gz
17	PDB:6ri5w	0.019	0.057	5.628	367	0.007	0.027	6ri5w.pdb.gz	Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
18	PDB:1dw9A	0.024	0.123	6.123	156	0.009	0.077	1dw9A.pdb.gz
19	PDB:3khdB	0.022	0.041	6.123	500	0.005	0.014	3khdB.pdb.gz
20	PDB:5kcvA	0.016	0.054	6.123	353	0.004	0.014	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WZ42	0.002	45.1	34350	0.025	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
2	A2ASS6	0.13	39.3	35213	0.079	0.003	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
3	O15016	1.4	35.8	1351	0.019	0.019	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
4	P41809	4.7	34.3	1802	0.060	0.045	HKR1_YEAST Signaling mucin HKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HKR1 PE=1 SV=2
5	Q63425	4.9	34.3	1383	0.059	0.058	PRAX_RAT Periaxin OS=Rattus norvegicus OX=10116 GN=Prx PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15363 DUF4596	4.5e-16	70.2	Domain of unknown function (DUF4596)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482374

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292586	0.630	MRN complex-interacting protein
2	9606.ENSP00000369849	0.630	Mesenteric estrogen-dependent adipogenesis protein
3	9606.ENSP00000401399	0.630	Myeloid differentiation primary response protein MyD88
4	9606.ENSP00000354724	0.602	Polycomb group RING finger protein 3
5	9606.ENSP00000368876	0.602	TOG array regulator of axonemal microtubules protein 2
6	9606.ENSP00000445905	0.602	EVI5-like protein
7	9606.ENSP00000405726	0.576	Cell division control protein 45 homolog
8	9606.ENSP00000326708	0.556	Ovochymase-1
9	9606.ENSP00000372720	0.519	Transmembrane protein 241
10	9606.ENSP00000413073	0.517	Zinc finger protein 445
11	9606.ENSP00000434727	0.517	Coiled-coil domain containing 180
12	9606.ENSP00000357575	0.502	Cilia- and flagella-associated protein 46

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.957	biological regulation
GO:0050789	0.954	regulation of biological process
GO:0050794	0.938	regulation of cellular process
GO:0071840	0.797	cellular component organization or biogenesis
GO:0016043	0.671	cellular component organization
GO:0032502	0.503	developmental process
GO:0008152	0.418	metabolic process
GO:0050896	0.405	response to stimulus
GO:0071704	0.401	organic substance metabolic process
GO:0044238	0.379	primary metabolic process
GO:0032501	0.365	multicellular organismal process
GO:0048856	0.356	anatomical structure development
GO:0019222	0.349	regulation of metabolic process
GO:0043170	0.336	macromolecule metabolic process
GO:0060255	0.332	regulation of macromolecule metabolic process
GO:0051179	0.321	localization
GO:0044237	0.304	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0005634	0.981	nucleus
GO:0031974	0.924	membrane-enclosed lumen
GO:0070013	0.906	intracellular organelle lumen
GO:0031981	0.812	nuclear lumen
GO:0005654	0.708	nucleoplasm
GO:0005829	0.604	cytosol
GO:0016020	0.600	membrane
GO:0043232	0.385	intracellular non-membrane-bounded organelle
GO:0012505	0.319	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]