StarFunc result for job id Q9H6N6

User Input

>input (1097 residues)
MGLKVIQQNVHKFLQLRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRKAMAQTQELVN
KVKELEEKTATLSQEKNDLTIQLQAEQENLMDAEERLTWMMKTKMDLESQISDMRERLEE
EEGMAASLSAAKRKLEGELSDLKRDLEGLETTLAKTEKEKQALDHKVRTLTGDLSLREDS
ITKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKNNSKLSTQIHELEDNWEQEKKIRAEV
EKARRKAESDLKMTIDNLNEMERSKLDLEEVVKKRDLEINSVNSKYEDEQSLNSTLQRKL
KEHQDRIEELEEELEAERAMRAKIEQNRKREAELLKLRRELEEAALQSEATASTLRKKHV
DSMAELTEHVESLQRVKSKLEKDKQVMKAEIDDLNASMETIQKSKMNAEAHVRKLEDSLS
EANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKR
QLDEESKSRSTAVVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYET
DAIQRTEELEETKRKLAARLQEAEEAAETAQARAASLEKNKQRLQAEVEDLTIDLEKANA
AAAALDKKQRLFDKMLAEWQQKCEELQVEVDSSQKECRMYMTESFKIKTAYEESLEHLES
VKKENKTLQEEIKDLIDQLGEGGRSVHELQKLKKKLEMEKEELQVALEEAESSLEVEESK
VIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKGRAEALRLKKK
METDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELRKQYNLQERR
LSLLQTELEEVRSALEGSERSRKLLEQEVVEITEWHNEINIQNQSLLVVKRKLESDVQRI
SNEHEELISEFRLTEERAKKAMMDAARMAEELRQEQDHCMHLEKIKKNYEVTIKDLQAKM
EEAEQLALKGGKRTIMKLEARIKELETELDGEQKQHVETVKTLCKNERRLKELVFQTEED
HKTNQRMQALVEKLQNKLKVYKRQIEEAEDQANQTLARYRKTVHELDDAEDRAGMAETAL
NKLRTRHRVAGKGITSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FD18	0.229	0.139	1.722E-62	1945	0.540	0.304	E7FD18.pdb.gz
2	AFDB:P11055	0.242	0.146	3.716E-62	1940	0.545	0.308	P11055.pdb.gz	MYH3_HUMAN Myosin-3 OS=Homo sapiens OX=9606 GN=MYH3 PE=1 SV=3
3	AFDB:A0A0N4STT5	0.247	0.146	4.352E-61	2008	0.552	0.302	A0A0N4STT5.pdb.gz
4	AFDB:P13533	0.230	0.139	8.051E-61	1939	0.554	0.314	P13533.pdb.gz	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5
5	AFDB:B8A568	0.229	0.139	1.876E-60	1937	0.539	0.305	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
6	AFDB:P05661	0.235	0.140	1.502E-58	1962	0.506	0.283	P05661.pdb.gz	MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4
7	AFDB:A7E2Y1	0.238	0.140	1.752E-58	1983	0.529	0.292	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
8	AFDB:G3UW82	0.229	0.137	1.892E-58	1942	0.537	0.303	G3UW82.pdb.gz	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
9	AFDB:P02566	0.224	0.135	1.804E-51	1963	0.449	0.251	P02566.pdb.gz	MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans OX=6239 GN=unc-54 PE=1 SV=2
10	AFDB:P12844	0.238	0.142	2.898E-48	1969	0.430	0.240	P12844.pdb.gz	MYO3_CAEEL Myosin-3 OS=Caenorhabditis elegans OX=6239 GN=myo-3 PE=2 SV=1
11	PDB:7mf3B	0.092	0.109	1.250E-3	896	0.054	0.066	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	716	1922	0.443	0.253	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	1035	1912	0.536	0.308	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	1048	1937	0.543	0.308	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	1050	1939	0.538	0.304	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	1030	1938	0.549	0.311	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A2AQP0	890	1941	0.532	0.301	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
7	A7E2Y1	893	1983	0.528	0.292	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
8	B1AR69	971	1938	0.521	0.295	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
9	B6IDE1	1049	1939	0.549	0.310	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
10	B6RK61	917	1941	0.531	0.300	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
11	B8A568	1017	1937	0.532	0.301	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
12	F1LMU0	1049	1939	0.538	0.304	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
13	F1LRV9	1050	1943	0.545	0.308	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
14	F1QZW1	1042	1938	0.551	0.312	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
15	F7F0L5	892	1929	0.521	0.296	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
16	G3UW82	1034	1942	0.534	0.302	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
17	G3V6E1	1037	1942	0.536	0.303	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4
18	I6L963	695	1598	0.366	0.252	I6L963_MOUSE Myh2 protein OS=Mus musculus OX=10090 GN=Myh2 PE=2 SV=1
19	P02562	970	1084	0.517	0.523	MYSS_RABIT Myosin heavy chain, skeletal muscle (Fragments) OS=Oryctolagus cuniculus OX=9986 PE=1 SV=2
20	P02563	1043	1938	0.552	0.312	MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19220 Crescentin	14	16.2	Crescentin protein
2	PF00038 Filament	2.4	19.3	Intermediate filament protein
3	PF05377 FlaC_arch	66	15.3	Flagella accessory protein C (FlaC)
4	PF01576 Myosin_tail_1	4.9e-143	490.0	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815752.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008974892.1	0.804	Troponin T, cardiac muscle isoform X1
2	9597.XP_003807017.1	0.802	Myosin light chain 1
3	9597.XP_008974890.1	0.799	Troponin I, slow skeletal muscle
4	9597.XP_003815230.1	0.792	Myosin binding protein C, cardiac
5	9597.XP_003818495.1	0.746	Myosin light chain 3
6	9597.XP_008959993.1	0.746	Myosin light chain 4
7	9597.XP_003807165.1	0.734	Troponin I3, cardiac type
8	9597.XP_008976862.1	0.731	Myosin light chain 6
9	9597.XP_008967349.1	0.717	Troponin T, fast skeletal muscle isoform X1
10	9597.XP_003828721.1	0.712	Alpha-actinin-3
11	9597.XP_003832516.1	0.691	Myosin light chain 2
12	9597.XP_008957488.1	0.691	Myosin regulatory light chain 10
13	9597.XP_003816126.1	0.677	Troponin I2, fast skeletal type
14	9597.NP_001266127.1	0.662	Transcriptional repressor that may play a role in the specification and differentiation of lung epithelium. May also play a role in developing neural, gastrointestinal and cardiovascular tissues. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays a role in synapse formation by regulating SRPX2 levels (By similarity)
15	9597.XP_003826032.1	0.662	Troponin C2, fast skeletal type
16	9597.XP_008967237.1	0.661	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 190 ESTs, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
17	9597.XP_003805261.1	0.658	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
18	9597.XP_003818806.1	0.655	Troponin C1, slow skeletal and cardiac type
19	9597.XP_003823126.1	0.655	Abnormal spindle-like microcephaly-associated protein isoform X1
20	9597.XP_003824564.2	0.651	Actinin alpha 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.997	cytoskeletal protein binding
GO:0003774	0.996	cytoskeletal motor activity
GO:0000146	0.972	microfilament motor activity
GO:0044877	0.843	protein-containing complex binding
GO:0005198	0.710	structural molecule activity
GO:0043167	0.333	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.955	developmental process
GO:0048856	0.923	anatomical structure development
GO:0032501	0.920	multicellular organismal process
GO:0007275	0.823	multicellular organism development
GO:0009987	0.723	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099080	0.987	supramolecular complex
GO:0099512	0.962	supramolecular fiber
GO:0005856	0.930	cytoskeleton
GO:0043292	0.929	contractile fiber
GO:0032991	0.905	protein-containing complex
GO:0015629	0.869	actin cytoskeleton
GO:0030016	0.732	myofibril
GO:0016459	0.573	myosin complex
GO:0030017	0.520	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.972	myosin ATPase.

[back to server]