StarFunc result for job id Q9H6P5

User Input

>input (420 residues)
MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKE
YKHVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIM
DGKSLNFGAVGALSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIP
SCPPNIMTTRFSLAAFKRNKRKLELAERVDTDFMQLKKRRQSSEKENDSGTLDTVGAVVV
DHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRT
ILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPDSSQN
KQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H6P5	1.000	1.000	1.969E-87	420	1.000	1.000	Q9H6P5.pdb.gz	TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens OX=9606 GN=TASP1 PE=1 SV=1
2	PDB:2a8iA	0.795	0.978	2.086E-63	341	0.805	0.991	2a8iA.pdb.gz
3	PDB:2a8jB	0.740	0.992	3.387E-57	313	0.743	0.997	2a8jB.pdb.gz	Crystal Structure of Human Taspase1, a Crucial Protease Regulating the Function of MLL.
4	AFDB:Q9VUX9	0.790	0.906	3.524E-43	365	0.362	0.416	Q9VUX9.pdb.gz	Q9VUX9_DROME LD05057p OS=Drosophila melanogaster OX=7227 GN=Tasp1 PE=1 SV=2
5	AFDB:Q9P6N7	0.749	0.906	1.523E-32	345	0.267	0.325	Q9P6N7.pdb.gz	TASP1_SCHPO Putative threonine aspartase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC823.09c PE=3 SV=3
6	AFDB:Q7L266	0.634	0.852	2.025E-28	308	0.271	0.370	Q7L266.pdb.gz	ASGL1_HUMAN Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2
7	AFDB:Q8VI04	0.630	0.785	2.052E-27	333	0.286	0.360	Q8VI04.pdb.gz	ASGL1_RAT Isoaspartyl peptidase/L-asparaginase OS=Rattus norvegicus OX=10116 GN=Asrgl1 PE=1 SV=1
8	PDB:4osxA	0.607	0.837	2.861E-26	300	0.281	0.393	4osxA.pdb.gz	Free Glycine Accelerates the Autoproteolytic Activation of Human Asparaginase.
9	AFDB:Q8GXG1	0.622	0.792	2.365E-25	325	0.221	0.286	Q8GXG1.pdb.gz	ASPGB_ARATH Probable isoaspartyl peptidase/L-asparaginase 2 OS=Arabidopsis thaliana OX=3702 GN=At3g16150 PE=2 SV=2
10	AFDB:P37595	0.644	0.831	2.814E-25	321	0.240	0.315	P37595.pdb.gz	IAAA_ECOLI Isoaspartyl peptidase OS=Escherichia coli (strain K12) OX=83333 GN=iaaA PE=1 SV=2
11	PDB:3c17B	0.634	0.858	7.000E-24	306	0.229	0.314	3c17B.pdb.gz
12	AFDB:P50287	0.631	0.833	9.076E-24	315	0.219	0.292	P50287.pdb.gz	ASPGA_ARATH Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidopsis thaliana OX=3702 GN=At5g08100 PE=1 SV=2
13	AFDB:A0A1D8PM71	0.642	0.839	3.061E-23	315	0.193	0.257	A0A1D8PM71.pdb.gz	A0A1D8PM71_CANAL Fgr10p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR10 PE=4 SV=1
14	AFDB:P20933	0.543	0.652	1.416E-20	346	0.198	0.240	P20933.pdb.gz	ASPG_HUMAN N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase OS=Homo sapiens OX=9606 GN=AGA PE=1 SV=2
15	PDB:7dvq3	0.092	0.044	4.164E-2	1193	0.052	0.018	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:7q4pC	0.081	0.050	1.771E-1	878	0.048	0.023	7q4pC.pdb.gz	Structural basis of branch site recognition by the human spliceosome.
17	PDB:6jshB	0.083	0.024	3.159E-1	1904	0.038	0.008	6jshB.pdb.gz
18	PDB:2bi0A	0.101	0.115	3.982E-1	330	0.064	0.082	2bi0A.pdb.gz
19	PDB:6ahrL	0.102	0.113	5.636E-1	362	0.086	0.099	6ahrL.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
20	PDB:4e3eA	0.082	0.091	7.105E-1	351	0.057	0.068	4e3eA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H6P5	0.0	866	420	1.000	1.000	TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens OX=9606 GN=TASP1 PE=1 SV=1
2	Q9VUX9	1.14e-76	244	365	0.360	0.414	Q9VUX9_DROME LD05057p OS=Drosophila melanogaster OX=7227 GN=Tasp1 PE=1 SV=2
3	Q9P6N7	3.86e-45	161	345	0.274	0.333	TASP1_SCHPO Putative threonine aspartase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC823.09c PE=3 SV=3
4	Q8C0M9	4.07e-40	147	326	0.264	0.340	ASGL1_MOUSE Isoaspartyl peptidase/L-asparaginase OS=Mus musculus OX=10090 GN=Asrgl1 PE=1 SV=1
5	Q7L266	3.58e-39	144	308	0.269	0.367	ASGL1_HUMAN Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2
6	Q8VI04	1.57e-37	140	333	0.262	0.330	ASGL1_RAT Isoaspartyl peptidase/L-asparaginase OS=Rattus norvegicus OX=10116 GN=Asrgl1 PE=1 SV=1
7	P37595	2.21e-30	121	321	0.210	0.274	IAAA_ECOLI Isoaspartyl peptidase OS=Escherichia coli (strain K12) OX=83333 GN=iaaA PE=1 SV=2
8	P50287	3.35e-23	101	315	0.181	0.241	ASPGA_ARATH Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidopsis thaliana OX=3702 GN=At5g08100 PE=1 SV=2
9	Q8GXG1	1.68e-22	99.4	325	0.205	0.265	ASPGB_ARATH Probable isoaspartyl peptidase/L-asparaginase 2 OS=Arabidopsis thaliana OX=3702 GN=At3g16150 PE=2 SV=2
10	P30919	4.61e-15	78.2	345	0.167	0.203	ASPG_RAT N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase OS=Rattus norvegicus OX=10116 GN=Aga PE=1 SV=2
11	Q64191	4.46e-13	72.4	346	0.160	0.194	ASPG_MOUSE N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase OS=Mus musculus OX=10090 GN=Aga PE=1 SV=1
12	A0A1D8PM71	2.33e-12	69.7	315	0.221	0.295	A0A1D8PM71_CANAL Fgr10p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR10 PE=4 SV=1
13	P20933	4.38e-11	66.2	346	0.164	0.199	ASPG_HUMAN N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase OS=Homo sapiens OX=9606 GN=AGA PE=1 SV=2
14	B5DFN4	4.5	30.8	154	0.043	0.117	B5DFN4_RAT Prefoldin 5 (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Pfdn5 PE=2 SV=1
15	A0A098D8A0	5.4	32.0	2352	0.036	0.006	ZEA2_GIBZE Highly reducing polyketide synthase ZEA2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEA2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01112 Asparaginase_2	9.1e-54	194.2	Asparaginase
2	PF12377 DuffyBP_N	3.3e+02	13.4	Duffy binding protein N terminal
3	PF04079 SMC_ScpB	5.7e+02	11.5	Segregation and condensation complex subunit ScpB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338624

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436786	0.817	Histone-lysine N-methyltransferase 2A
2	9606.ENSP00000450040	0.790	60 kDa lysophospholipase
3	9606.ENSP00000452454	0.746	Transcription initiation factor IIA subunit 1
4	9606.ENSP00000340427	0.729	Endoplasmic reticulum metallopeptidase 1
5	9606.ENSP00000311713	0.726	Serine/threonine-protein kinase OSR1
6	9606.ENSP00000348278	0.726	STE20/SPS1-related proline-alanine-rich protein kinase
7	9606.ENSP00000398837	0.715	Histone-lysine N-methyltransferase 2B
8	9606.ENSP00000310117	0.692	Protein phosphatase 1 regulatory subunit 14B
9	9606.ENSP00000362551	0.676	Zinc finger and BTB domain-containing protein 34
10	9606.ENSP00000384545	0.674	BTB/POZ domain-containing protein 3
11	9606.ENSP00000218176	0.670	Potassium voltage-gated channel subfamily D member 1
12	9606.ENSP00000319591	0.670	Potassium voltage-gated channel subfamily D member 3
13	9606.ENSP00000333496	0.670	Potassium voltage-gated channel subfamily D member 2
14	9606.ENSP00000296930	0.629	Nucleophosmin
15	9606.ENSP00000444136	0.627	DNA-directed RNA polymerase I subunit RPA2
16	9606.ENSP00000375767	0.622	Caspase recruitment domain-containing protein 8
17	9606.ENSP00000384164	0.610	Kinesin-like protein KIF16B
18	9606.ENSP00000337088	0.604	Menin
19	9606.ENSP00000309555	0.600	Host cell factor 1
20	9606.ENSP00000301067	0.595	Histone-lysine N-methyltransferase 2D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0070003	1.000	threonine-type peptidase activity
GO:0004175	1.000	endopeptidase activity
GO:0004298	0.982	threonine-type endopeptidase activity
GO:0016811	0.618	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.990	regulation of gene expression
GO:0048522	0.989	positive regulation of cellular process
GO:0009889	0.988	regulation of biosynthetic process
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0043170	0.977	macromolecule metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0045893	0.973	positive regulation of DNA-templated transcription
GO:0019538	0.956	protein metabolic process
GO:0006508	0.842	proteolysis
GO:0009987	0.737	cellular process
GO:0044237	0.318	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0070013	0.998	intracellular organelle lumen
GO:0005634	0.997	nucleus
GO:0031981	0.994	nuclear lumen
GO:0005829	0.988	cytosol
GO:0005654	0.972	nucleoplasm
GO:0032991	0.920	protein-containing complex
GO:0016020	0.792	membrane
GO:0043228	0.395	non-membrane-bounded organelle
GO:0043232	0.394	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.25.-	0.982	Threonine endopeptidases.
EC:3.5.1.-	0.618	In linear amides.

[back to server]