StarFunc result for job id Q9H6R0

User Input

>input (707 residues)
MPEEAGFPPAKRFRPGSGPPSRAGSFPPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSA
SPYPEAVELQRRSLPIFQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQG
IIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFDDVTSEDTRIKFLTDGMLLREAI
SDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSATMDVDLFS
QYFNGAPVLYLEGRQHPIQVFYTKQPQNDYLHAALVSVFQIHQEAPSSQDILVFLTGQEE
IEAMSKTCRDIAKHLPDGCPAMLVLPLYASLPYAQQLRVFQGAPKGYRKVIISTNIAETS
ITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTE
DEFEKFDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGA
LEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMSPKFHCTEEILTIVSLLSVDSVLHNPPS
RREEVQGVRKKFISSEGDHMTLLNIYRTFKNLGGNKDWCKENFVNSKNMTLVAEVRAQLR
DICLKMSMPIASSRGDVESVRRCLAHSLFMSTAELQPDGTYATTDTHQPVAIHPSSVLFH
CKPACVVYTELLYTNKCYMRDLCVIDAQWLYEAAPEYFRRKLRTARN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H6R0	1.000	1.000	0.000	707	1.000	1.000	Q9H6R0.pdb.gz	DHX33_HUMAN ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2
2	AFDB:X1WET4	0.897	0.932	0.000	680	0.707	0.735	X1WET4.pdb.gz	X1WET4_DANRE ATP-dependent RNA helicase DHX33 OS=Danio rerio OX=7955 GN=si:ch211-160e1.10 PE=1 SV=1
3	AFDB:Q9VL25	0.890	0.907	2.576E-81	694	0.423	0.431	Q9VL25.pdb.gz	DHX33_DROME ATP-dependent RNA helicase DHX33 OS=Drosophila melanogaster OX=7227 GN=ath PE=1 SV=2
4	AFDB:Q03319	0.859	0.846	1.613E-78	719	0.421	0.414	Q03319.pdb.gz	PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prh1 PE=3 SV=2
5	AFDB:A2ACQ1	0.886	0.891	7.687E-77	703	0.417	0.420	A2ACQ1.pdb.gz	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
6	AFDB:F4IE66	0.866	0.854	1.629E-76	717	0.429	0.423	F4IE66.pdb.gz	PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana OX=3702 GN=RID1 PE=1 SV=1
7	AFDB:Q09530	0.829	0.498	1.252E-75	1200	0.423	0.249	Q09530.pdb.gz	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
8	AFDB:F4IJV4	0.854	0.584	3.663E-75	1044	0.386	0.261	F4IJV4.pdb.gz	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
9	AFDB:Q8VY00	0.852	0.583	2.815E-74	1044	0.393	0.266	Q8VY00.pdb.gz	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
10	AFDB:Q9VIZ3	0.853	0.678	4.324E-74	894	0.386	0.305	Q9VIZ3.pdb.gz	Q9VIZ3_DROME LD25692p OS=Drosophila melanogaster OX=7227 GN=l(2)37Cb PE=1 SV=1
11	PDB:5xjcY	0.847	0.840	3.902E-68	713	0.421	0.418	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
12	PDB:6id1V	0.864	0.921	3.355E-66	663	0.386	0.412	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:6ff7q	0.825	0.929	3.372E-65	625	0.409	0.462	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:5ylzW	0.834	0.838	1.103E-63	703	0.393	0.395	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
15	PDB:3kx2B	0.844	0.792	2.748E-63	755	0.392	0.367	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
16	PDB:5wsge	0.768	0.797	1.615E-62	679	0.373	0.389	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
17	PDB:7dcpx	0.849	0.894	1.388E-60	670	0.354	0.373	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
18	PDB:5yzgZ	0.745	0.822	3.666E-59	635	0.375	0.417	5yzgZ.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:7dvqx	0.781	0.917	2.307E-55	599	0.395	0.466	7dvqx.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:5gm6Y	0.789	0.929	4.205E-53	598	0.345	0.408	5gm6Y.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z9L3	0.0	572	1242	0.424	0.242	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
2	A2ACQ1	0.0	555	703	0.412	0.414	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
3	F4IE66	0.0	610	717	0.427	0.421	PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana OX=3702 GN=RID1 PE=1 SV=1
4	I3L1L6	0.0	1165	617	0.792	0.908	I3L1L6_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=1
5	O60231	0.0	566	1041	0.427	0.290	DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2
6	Q03319	0.0	569	719	0.407	0.401	PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prh1 PE=3 SV=2
7	Q05BE5	0.0	684	483	0.460	0.673	Q05BE5_HUMAN DEAH (Asp-Glu-Ala-His) box polypeptide 33, isoform CRA_c OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=1
8	Q09530	0.0	581	1200	0.427	0.252	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
9	Q14562	0.0	577	1220	0.424	0.246	DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
10	Q38953	0.0	570	1168	0.406	0.246	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
11	Q5SQH4	0.0	566	1041	0.427	0.290	Q5SQH4_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX16 PE=2 SV=1
12	Q7ZVV8	0.0	555	1054	0.413	0.277	Q7ZVV8_DANRE RNA helicase OS=Danio rerio OX=7955 GN=zgc:55590 PE=1 SV=1
13	Q80VY9	0.0	1342	698	0.926	0.938	DHX33_MOUSE ATP-dependent RNA helicase DHX33 OS=Mus musculus OX=10090 GN=Dhx33 PE=1 SV=1
14	Q86YB2	0.0	577	1220	0.424	0.246	Q86YB2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=2
15	Q8VY00	0.0	545	1044	0.399	0.270	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
16	Q9H5Z1	0.0	560	703	0.414	0.417	DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens OX=9606 GN=DHX35 PE=1 SV=2
17	Q9H6R0	0.0	1468	707	1.000	1.000	DHX33_HUMAN ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2
18	Q9VL25	0.0	589	694	0.421	0.429	DHX33_DROME ATP-dependent RNA helicase DHX33 OS=Drosophila melanogaster OX=7227 GN=ath PE=1 SV=2
19	X1WET4	0.0	1049	680	0.710	0.738	X1WET4_DANRE ATP-dependent RNA helicase DHX33 OS=Danio rerio OX=7955 GN=si:ch211-160e1.10 PE=1 SV=1
20	F4IJV4	2.14e-180	543	1044	0.389	0.263	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	1.2e+02	14.3	AAA domain
2	PF13401 AAA_22	3.4	19.4	AAA domain
3	PF00005 ABC_tran	82	15.1	ABC transporter
4	PF00270 DEAD	0.0032	28.8	DEAD/DEAH box helicase
5	PF04408 HA2	9.4e-16	69.3	Helicase associated domain (HA2)
6	PF00271 Helicase_C	7.5e-10	50.5	Helicase conserved C-terminal domain
7	PF07717 OB_NTP_bind	4.9e-14	63.8	Oligonucleotide/oligosaccharide-binding (OB)-fold

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337383	0.998	NACHT, LRR and PYD domains-containing protein 3
2	9606.ENSP00000247003	0.989	Probable ATP-dependent RNA helicase DDX49
3	9606.ENSP00000275820	0.978	Nucleolar MIF4G domain-containing protein 1
4	9606.ENSP00000230340	0.971	Bystin
5	9606.ENSP00000244230	0.971	U3 small nucleolar ribonucleoprotein protein MPP10
6	9606.ENSP00000225298	0.968	U3 small nucleolar RNA-associated protein 18 homolog
7	9606.ENSP00000232888	0.968	U3 small nucleolar RNA-interacting protein 2
8	9606.ENSP00000384302	0.967	WD repeat-containing protein 43
9	9606.ENSP00000401980	0.967	Mitochondrial antiviral-signaling protein
10	9606.ENSP00000419005	0.967	Digestive organ expansion factor homolog
11	9606.ENSP00000297990	0.966	Nucleolar protein 6
12	9606.ENSP00000405068	0.964	Nucleolar protein 14
13	9606.ENSP00000269349	0.963	Eukaryotic initiation factor 4A-III
14	9606.ENSP00000261708	0.962	U3 small nucleolar RNA-associated protein 6 homolog
15	9606.ENSP00000336741	0.962	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
16	9606.ENSP00000481495	0.961	ATP-dependent RNA helicase DDX24
17	9606.ENSP00000258772	0.957	Probable ATP-dependent RNA helicase DDX56
18	9606.ENSP00000323858	0.957	ATP-dependent RNA helicase DDX54
19	9606.ENSP00000314348	0.955	Probable ATP-dependent RNA helicase DDX10
20	9606.ENSP00000423067	0.954	WD repeat-containing protein 36

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003723	0.995	RNA binding
GO:0003725	0.989	double-stranded RNA binding
GO:0003824	0.926	catalytic activity
GO:0140657	0.872	ATP-dependent activity
GO:0140098	0.859	catalytic activity, acting on RNA
GO:0004386	0.827	helicase activity
GO:0003677	0.668	DNA binding
GO:0008186	0.664	ATP-dependent activity, acting on RNA
GO:0003724	0.551	RNA helicase activity
GO:0000182	0.495	rDNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006356	0.987	regulation of transcription by RNA polymerase I
GO:0009987	0.891	cellular process
GO:0009893	0.856	positive regulation of metabolic process
GO:0071704	0.767	organic substance metabolic process
GO:0048522	0.741	positive regulation of cellular process
GO:0044238	0.733	primary metabolic process
GO:0006807	0.729	nitrogen compound metabolic process
GO:0043170	0.716	macromolecule metabolic process
GO:0044237	0.616	cellular metabolic process
GO:0010604	0.608	positive regulation of macromolecule metabolic process
GO:0034641	0.506	cellular nitrogen compound metabolic process
GO:0031325	0.430	positive regulation of cellular metabolic process
GO:0010467	0.417	gene expression
GO:0051173	0.344	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.986	nucleolus
GO:0005829	0.967	cytosol
GO:0032991	0.964	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.551	RNA helicase.

[back to server]