StarFunc result for job id Q9H6R3

User Input

>input (686 residues)
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRH
IENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQ
AMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEE
ALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTS
GTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGN
TTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKT
LFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP
GYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDA
GYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLA
LCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVN
GKPYKITSTIEDPSIFGHVEEMLKQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H6R3	1.000	1.000	0.000	686	1.000	1.000	Q9H6R3.pdb.gz	ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1
2	AFDB:Q9VC92	0.902	0.918	3.162E-94	674	0.433	0.441	Q9VC92.pdb.gz	Q9VC92_DROME GH15945p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6432 PE=2 SV=1
3	AFDB:P77495	0.875	0.955	3.216E-83	628	0.362	0.395	P77495.pdb.gz	PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=prpE PE=3 SV=1
4	AFDB:P55912	0.875	0.954	1.192E-81	628	0.360	0.393	P55912.pdb.gz	PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=prpE PE=3 SV=2
5	AFDB:Q726Y7	0.871	0.903	4.661E-76	661	0.340	0.352	Q726Y7.pdb.gz	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
6	AFDB:P9WQD1	0.850	0.895	1.022E-74	651	0.340	0.358	P9WQD1.pdb.gz	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
7	AFDB:Q973W5	0.857	0.891	5.872E-74	659	0.345	0.360	Q973W5.pdb.gz	HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_07830 PE=1 SV=1
8	AFDB:Q5E268	0.869	0.917	1.723E-72	649	0.327	0.345	Q5E268.pdb.gz	Q5E268_ALIF1 Acetyl-coenzyme A synthetase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=acs PE=3 SV=2
9	AFDB:Q9NUB1	0.872	0.869	1.250E-71	689	0.324	0.322	Q9NUB1.pdb.gz	ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS1 PE=1 SV=2
10	AFDB:Q01574	0.706	0.680	3.174E-71	713	0.345	0.332	Q01574.pdb.gz	ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS1 PE=1 SV=2
11	PDB:2p20A	0.715	0.764	3.483E-71	641	0.331	0.354	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
12	PDB:1ry2A	0.843	0.938	1.676E-68	615	0.340	0.379	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
13	PDB:3b7wA	0.570	0.720	1.999E-43	537	0.200	0.255	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
14	PDB:6q2mA	0.668	0.831	4.365E-38	544	0.175	0.221	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
15	PDB:7kydA	0.650	0.821	3.556E-37	534	0.166	0.213	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
16	PDB:5bsmA	0.665	0.848	1.140E-36	530	0.172	0.223	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
17	PDB:1ultA	0.578	0.731	1.440E-36	533	0.182	0.235	1ultA.pdb.gz
18	PDB:5ie2A	0.636	0.848	4.109E-36	506	0.168	0.227	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
19	PDB:3r44A	0.557	0.739	6.941E-36	502	0.173	0.237	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
20	PDB:5ja2A	0.514	0.297	6.720E-33	1238	0.153	0.085	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1R2	0.0	1409	685	0.999	1.000	A0A0B4J1R2_HUMAN propionate--CoA ligase OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1
2	A0A0G2K047	0.0	1301	683	0.908	0.912	ACSS3_RAT Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acss3 PE=1 SV=1
3	Q14DH7	0.0	1301	682	0.902	0.908	ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus OX=10090 GN=Acss3 PE=1 SV=2
4	Q9H6R3	0.0	1417	686	1.000	1.000	ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1
5	Q9VC92	0.0	638	674	0.431	0.439	Q9VC92_DROME GH15945p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6432 PE=2 SV=1
6	P55912	9.85e-150	450	628	0.364	0.398	PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=prpE PE=3 SV=2
7	P77495	1.62e-148	447	628	0.370	0.404	PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=prpE PE=3 SV=1
8	Q6FLU2	3.37e-137	421	704	0.359	0.349	ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACS1 PE=3 SV=1
9	Q726Y7	3.73e-137	419	661	0.350	0.363	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
10	P9WQD1	1.20e-136	417	651	0.344	0.363	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
11	Q01574	5.55e-133	410	713	0.359	0.345	ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS1 PE=1 SV=2
12	Q973W5	7.83e-130	400	659	0.357	0.372	HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_07830 PE=1 SV=1
13	Q5E268	1.46e-129	399	649	0.343	0.362	Q5E268_ALIF1 Acetyl-coenzyme A synthetase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=acs PE=3 SV=2
14	Q8ZKF6	5.10e-127	392	652	0.341	0.359	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
15	A4YGR1	1.67e-126	391	661	0.341	0.354	HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_1456 PE=1 SV=1
16	P27550	9.84e-125	387	652	0.334	0.351	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
17	P52910	1.53e-124	387	683	0.337	0.338	ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS2 PE=1 SV=1
18	P78773	1.19e-121	379	662	0.337	0.349	ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC191.02c PE=1 SV=2
19	B9DGD6	1.25e-120	379	743	0.331	0.306	ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=ACS PE=1 SV=1
20	P16928	1.06e-119	374	670	0.345	0.354	ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=facA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16177 ACAS_N	9.1e-17	72.0	Acetyl-coenzyme A synthetase N-terminus
2	PF00501 AMP-binding	8.1e-77	270.3	AMP-binding enzyme
3	PF13193 AMP-binding_C	3.6e-18	77.6	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449535

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365462	0.938	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
2	9606.ENSP00000345774	0.932	Fatty aldehyde dehydrogenase
3	9606.ENSP00000261733	0.930	Aldehyde dehydrogenase, mitochondrial
4	9606.ENSP00000419027	0.925	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
5	9606.ENSP00000293217	0.923	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000450436	0.923	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
7	9606.ENSP00000316924	0.921	Acetyl-coenzyme A synthetase 2-like, mitochondrial
8	9606.ENSP00000253382	0.920	Acetyl-coenzyme A synthetase, cytoplasmic
9	9606.ENSP00000242592	0.914	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000359151	0.910	Dihydrolipoamide branched chain transacylase E2
11	9606.ENSP00000436585	0.910	Ethylmalonyl-CoA decarboxylase
12	9606.ENSP00000348775	0.909	Peroxisomal acyl-coenzyme A oxidase 3
13	9606.ENSP00000285093	0.867	3-ketoacyl-CoA thiolase, mitochondrial
14	9606.ENSP00000325136	0.865	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
15	9606.ENSP00000346827	0.855	4-trimethylaminobutyraldehyde dehydrogenase
16	9606.ENSP00000366927	0.854	Aldehyde dehydrogenase X, mitochondrial
17	9606.ENSP00000231887	0.840	Peroxisomal bifunctional enzyme
18	9606.ENSP00000333664	0.839	3-ketoacyl-CoA thiolase, peroxisomal
19	9606.ENSP00000387123	0.837	Alpha-aminoadipic semialdehyde dehydrogenase
20	9606.ENSP00000231420	0.828	Alanine--glyoxylate aminotransferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003987	1.000	acetate-CoA ligase activity
GO:0005488	0.994	binding
GO:0005515	0.941	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006091	0.949	generation of precursor metabolites and energy
GO:0009058	0.915	biosynthetic process
GO:1901576	0.894	organic substance biosynthetic process
GO:0006629	0.889	lipid metabolic process
GO:0044249	0.868	cellular biosynthetic process
GO:0044283	0.847	small molecule biosynthetic process
GO:0008610	0.818	lipid biosynthetic process
GO:1901568	0.814	fatty acid derivative metabolic process
GO:0006807	0.486	nitrogen compound metabolic process
GO:1901564	0.353	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005759	0.903	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23176	1.000	acetate + ATP + CoA = acetyl-CoA + AMP + diphosphate
EC:6.2.1.1	1.000	acetate--CoA ligase.

[back to server]