StarFunc result for job id Q9H6S0

User Input

>input (1430 residues)
MSRPSSVSPRQPAPGGGGGGGPSPCGPGGGGRAKGLKDIRIDEEVKIAVNIALERFRYGD
QREMEFPSSLTSTERAFIHRLSQSLGLVSKSKGKGANRYLTVKKKDGSETAHAMMTCNLT
HNTKHAVRSLIQRFPVTNKERTELLPKTERGNVFAVEAENREMSKTSGRLNNGIPQIPVK
RGESEFDSFRQSLPVFEKQEEIVKIIKENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIP
CRIFCTQPRRLAAIAVAERVAAERRERIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTL
MAGDSTLSTVTHVIVDEVHERDRFSDFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYF
GSCPVIYIQGRPFEVKEMFLEDILRTTGYTNKEMLKYKKEKQQEEKQQTTLTEWYSAQEN
SFKPESQRQRTVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHK
DIDAFAQVFHLILTENVSVDYRHSETSATALMVAAGRGFASQVEQLISMGANVHSKASNG
WMALDWAKHFGQTEIVDLLESYSATLEFGNLDESSLVQTNGSDLSAEDRELLKAYHHSFD
DEKVDLDLIMHLLYNICHSCDAGAVLIFLPGYDEIVGLRDRILFDDKRFADSTHRYQVFM
LHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVIDSGKVKEKSFDALNFV
TMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQTPELLRMPLQELCLHT
KLLAPVNCPIADFLMKAPEPPPALIVRNAVQMLKTIDAMDTWEDLTELGYHLADLPVEPH
LGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLCRKRFTAGAFSDHMAL
LRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLRASGFVRARGGGDIRD
VNTNSENWAVVKAALVAGMYPNLVHVDRENLVLTGPKEKKVRFHPASVLSQPQYKKIPPA
NGQAAAIKALPTDWLIYDEMTRAHRIANIRCCSAVTPVTILVFCGPARLASNALQEPSSF
RVDGIPNDSSDSEMEDKTTANLAALKLDEWLHFTLEPEAASLLLQLRQKWHSLFLRRMRA
PSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRK
SSADTEFSDECTTAERVLMKSPSPALHPPQKYKDRGILHPKRGTEDRSDQSSLKSTDSSS
YPSPCASPSPPSSGKGSKSPSPRPNMPVRYFIMKSSNLRNLEISQQKGIWSTTPSNERKL
NRAFWESSIVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSAGLGGVFKVEWIRKESLP
FQFAHHLLNPWNDNKKVQISRDGQELEPLVGEQLLQLWERLPLGEKNTTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RR83	0.723	0.717	0.000	1445	0.970	0.960	B2RR83.pdb.gz	YTDC2_MOUSE 3'-5' RNA helicase YTHDC2 OS=Mus musculus OX=10090 GN=Ythdc2 PE=1 SV=1
2	AFDB:F4ILR7	0.516	0.729	9.162E-75	995	0.245	0.352	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
3	AFDB:Q05B79	0.484	0.679	9.528E-67	1010	0.243	0.344	Q05B79.pdb.gz	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
4	AFDB:Q9W1I2	0.581	0.673	2.196E-66	1215	0.199	0.234	Q9W1I2.pdb.gz	BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster OX=7227 GN=bgcn PE=1 SV=2
5	AFDB:Q6P158	0.471	0.485	1.668E-63	1386	0.231	0.239	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
6	AFDB:Q28141	0.473	0.520	4.565E-61	1287	0.241	0.268	Q28141.pdb.gz	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
7	AFDB:Q8SWT2	0.465	0.675	4.565E-61	942	0.208	0.315	Q8SWT2.pdb.gz	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
8	AFDB:Q583S9	0.458	0.516	9.153E-61	1251	0.210	0.240	Q583S9.pdb.gz	Q583S9_TRYB2 ATP-dependent DEAH-box RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.660 PE=4 SV=1
9	AFDB:O70133	0.473	0.488	5.679E-59	1380	0.236	0.245	O70133.pdb.gz	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
10	AFDB:P24785	0.477	0.522	1.729E-58	1293	0.239	0.265	P24785.pdb.gz	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
11	PDB:5vheA	0.430	0.666	4.396E-56	871	0.222	0.364	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
12	PDB:5n9dB	0.453	0.704	1.338E-55	866	0.201	0.331	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
13	PDB:5aorA	0.472	0.645	7.568E-54	1009	0.219	0.310	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
14	PDB:5ylzW	0.370	0.713	9.378E-41	703	0.152	0.310	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
15	PDB:3kx2B	0.380	0.682	1.795E-40	755	0.152	0.287	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
16	PDB:6id1V	0.357	0.712	3.281E-40	663	0.153	0.330	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:5xjcY	0.375	0.712	1.319E-39	713	0.145	0.290	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:6ff7q	0.362	0.775	3.040E-39	625	0.145	0.331	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dcpx	0.349	0.691	5.392E-38	670	0.137	0.293	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:5wsge	0.313	0.587	3.291E-37	679	0.146	0.308	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RR83	0.0	2895	1445	0.971	0.961	YTDC2_MOUSE 3'-5' RNA helicase YTHDC2 OS=Mus musculus OX=10090 GN=Ythdc2 PE=1 SV=1
2	Q9H6S0	0.0	2973	1430	1.000	1.000	YTDC2_HUMAN 3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2
3	F4IDQ6	1.58e-178	576	1576	0.269	0.244	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
4	Q05B79	5.41e-103	355	1010	0.153	0.217	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
5	Q8VHK9	5.00e-102	352	1001	0.148	0.211	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
6	D4A2Z8	1.64e-101	350	1000	0.148	0.211	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
7	F4ILR7	1.68e-101	350	995	0.148	0.212	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
8	Q9H2U1	1.85e-101	350	1008	0.148	0.210	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
9	E7EWK3	4.37e-96	330	797	0.129	0.231	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
10	Q7Z478	6.20e-83	301	1369	0.138	0.144	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
11	Q6PGC1	1.05e-82	301	1365	0.137	0.144	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
12	F4HYJ6	1.39e-80	293	1206	0.132	0.157	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
13	Q6P158	1.89e-80	294	1386	0.130	0.134	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
14	Q8SWT2	3.13e-79	285	942	0.113	0.171	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
15	Q28141	4.43e-76	280	1287	0.148	0.164	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
16	Q08211	1.33e-75	278	1270	0.145	0.163	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
17	H7BXY3	1.26e-73	271	1166	0.117	0.144	H7BXY3_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
18	O70133	1.51e-73	272	1380	0.145	0.150	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
19	Q7L2E3	2.10e-73	270	1194	0.117	0.141	DHX30_HUMAN ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
20	Q5BJS0	4.39e-73	270	1194	0.119	0.142	DHX30_RAT ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus OX=10116 GN=Dhx30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	0.29	22.8	AAA domain
2	PF13401 AAA_22	1	21.0	AAA domain
3	PF13476 AAA_23	2.7e+02	13.5	AAA domain
4	PF13555 AAA_29	2.1e+02	13.1	P-loop containing region of AAA domain
5	PF13604 AAA_30	1.4e+02	13.6	AAA domain
6	PF12775 AAA_7	60	14.6	P-loop containing dynein motor region
7	PF00005 ABC_tran	3.9e+02	13.0	ABC transporter
8	PF12796 Ank_2	0.9	21.5	Ankyrin repeats (3 copies)
9	PF06745 ATPase	7.1	17.5	KaiC
10	PF00270 DEAD	2.6e-06	38.8	DEAD/DEAH box helicase
11	PF04408 HA2	8.6e-15	66.2	Helicase associated domain (HA2)
12	PF00271 Helicase_C	9.7e-12	56.6	Helicase conserved C-terminal domain
13	PF07717 OB_NTP_bind	4e-08	44.8	Oligonucleotide/oligosaccharide-binding (OB)-fold
14	PF02562 PhoH	11	17.0	PhoH-like protein
15	PF01424 R3H	1.9e-07	42.3	R3H domain
16	PF00448 SRP54	4.7e+02	11.8	SRP54-type protein, GTPase domain
17	PF00437 T2SSE	5e+02	11.1	Type II/IV secretion system protein
18	PF04146 YTH	5.4e-39	145.7	YT521-B-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000161863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264951	0.987	5'-3' exoribonuclease 1
2	9606.ENSP00000386452	0.961	Meiosis-specific coiled-coil domain-containing protein MEIOC
3	9606.ENSP00000484669	0.931	Cleavage and polyadenylation specificity factor subunit 1
4	9606.ENSP00000315791	0.911	Cleavage stimulation factor subunit 3
5	9606.ENSP00000298875	0.910	Cleavage and polyadenylation specificity factor subunit 2
6	9606.ENSP00000247003	0.904	Probable ATP-dependent RNA helicase DDX49
7	9606.ENSP00000217109	0.899	Cleavage stimulation factor subunit 1
8	9606.ENSP00000300291	0.880	Cleavage and polyadenylation specificity factor subunit 5
9	9606.ENSP00000336752	0.875	Pre-mRNA 3'-end-processing factor FIP1
10	9606.ENSP00000351141	0.875	Pre-mRNA-splicing regulator WTAP
11	9606.ENSP00000298717	0.843	N6-adenosine-methyltransferase catalytic subunit
12	9606.ENSP00000373474	0.837	N6-adenosine-methyltransferase non-catalytic subunit
13	9606.ENSP00000311135	0.831	Probable ATP-dependent RNA helicase DHX37
14	9606.ENSP00000238146	0.825	ATP-dependent RNA helicase DDX55
15	9606.ENSP00000314348	0.814	Probable ATP-dependent RNA helicase DDX10
16	9606.ENSP00000297591	0.809	Protein virilizer homolog
17	9606.ENSP00000230640	0.805	Superkiller viralicidic activity 2-like 2
18	9606.ENSP00000483495	0.802	Probable ATP-dependent RNA helicase DDX27
19	9606.ENSP00000372199	0.793	Nucleolar pre-ribosomal-associated protein 1
20	9606.ENSP00000382091	0.792	RNA demethylase ALKBH5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003724	1.000	RNA helicase activity
GO:1990247	0.994	N6-methyladenosine-containing RNA binding
GO:0019899	0.592	enzyme binding
GO:0034458	0.421	3'-5' RNA helicase activity
GO:0003677	0.354	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050789	0.898	regulation of biological process
GO:0050794	0.873	regulation of cellular process
GO:0008152	0.604	metabolic process
GO:0071704	0.573	organic substance metabolic process
GO:0044238	0.527	primary metabolic process
GO:0044237	0.522	cellular metabolic process
GO:0048518	0.494	positive regulation of biological process
GO:0019222	0.479	regulation of metabolic process
GO:0006807	0.445	nitrogen compound metabolic process
GO:0048519	0.444	negative regulation of biological process
GO:0043170	0.439	macromolecule metabolic process
GO:0060255	0.404	regulation of macromolecule metabolic process
GO:0048522	0.400	positive regulation of cellular process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0034641	0.396	cellular nitrogen compound metabolic process
GO:0046483	0.346	heterocycle metabolic process
GO:0090304	0.343	nucleic acid metabolic process
GO:0050896	0.337	response to stimulus
GO:0010468	0.334	regulation of gene expression
GO:0048523	0.330	negative regulation of cellular process
GO:0071840	0.322	cellular component organization or biogenesis
GO:0080090	0.307	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0043233	0.885	organelle lumen
GO:0070013	0.882	intracellular organelle lumen
GO:0012505	0.810	endomembrane system
GO:0005634	0.791	nucleus
GO:0035770	0.426	ribonucleoprotein granule
GO:0031981	0.384	nuclear lumen
GO:0005783	0.344	endoplasmic reticulum
GO:0005654	0.328	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	1.000	RNA helicase.

[back to server]