StarFunc result for job id Q9H6S3

User Input

>input (715 residues)
MSQSGAVSCCPGATNGSLGRSDGVAKMSPKDLFEQRKKYSNSNVIMHETSQYHVQHLATF
IMDKSEAITSVDDAIRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDIESQEELEDFPLPTV
QRSQTVLNQLRYPSVLLLVCQDSEQSKPDVHFFHCDEVEAELVHEDIESALADCRLGKKM
RPQTLKGHQEKIRQRQSILPPPQGPAPIPFQHRGGDSPEAKNRVGPQVPLSEPGFRRRES
QEEPRAVLAQKIEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEG
VLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCSG
PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFH
SGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPVSS
PHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGY
VPCNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPGNKDELMQHMDEVNDELIRK
ISNIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFS
LNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A3B3ISQ4	0.588	0.536	0.000	788	0.964	0.874	A0A3B3ISQ4.pdb.gz	A0A3B3ISQ4_HUMAN EPS8 like 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=1
2	AFDB:Q99K30	0.556	0.546	5.125E-99	729	0.856	0.840	Q99K30.pdb.gz	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
3	AFDB:F1M3L7	0.545	0.477	8.528E-61	822	0.456	0.397	F1M3L7.pdb.gz	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
4	AFDB:Q8TE68	0.466	0.461	8.963E-56	723	0.393	0.389	Q8TE68.pdb.gz	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
5	AFDB:Q8TE67	0.217	0.260	3.358E-42	593	0.290	0.349	Q8TE67.pdb.gz	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
6	AFDB:Q8IPW1	0.398	0.356	3.356E-37	805	0.269	0.239	Q8IPW1.pdb.gz	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
7	AFDB:G5EFE0	0.257	0.249	1.285E-32	740	0.241	0.232	G5EFE0.pdb.gz	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
8	AFDB:E7EQN5	0.093	0.074	2.120E-7	925	0.108	0.083	E7EQN5.pdb.gz	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
9	AFDB:Q5I2Z0	0.098	0.158	2.346E-7	424	0.088	0.149	Q5I2Z0.pdb.gz	Q5I2Z0_RAT Protein kinase C and casein kinase substrate in neurons 3 OS=Rattus norvegicus OX=10116 GN=Pacsin3 PE=1 SV=1
10	AFDB:Q4V920	0.082	0.124	2.871E-7	445	0.094	0.151	Q4V920.pdb.gz	PACN1_DANRE Protein kinase C and casein kinase substrate in neurons protein 1 OS=Danio rerio OX=7955 GN=pacsin1b PE=1 SV=1
11	PDB:2eyzA	0.083	0.188	7.297E-5	304	0.036	0.086	2eyzA.pdb.gz
12	PDB:3qwyA	0.079	0.321	6.083E-4	170	0.022	0.094	3qwyA.pdb.gz
13	PDB:2lqnA	0.075	0.172	7.445E-4	303	0.036	0.086	2lqnA.pdb.gz
14	PDB:1k9aB	0.077	0.123	1.060E-3	441	0.018	0.029	1k9aB.pdb.gz
15	PDB:1griA	0.081	0.271	1.847E-3	211	0.024	0.081	1griA.pdb.gz
16	PDB:3ehqA	0.078	0.290	1.847E-3	182	0.021	0.082	3ehqA.pdb.gz
17	PDB:3uzsA	0.115	0.132	3.561E-3	609	0.027	0.031	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:1k0xA	0.076	0.453	4.359E-3	108	0.021	0.139	1k0xA.pdb.gz
19	PDB:4mk0A	0.120	0.134	5.071E-3	631	0.028	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:2dybA	0.076	0.177	7.989E-3	298	0.021	0.050	2dybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISQ4	0.0	1417	788	0.964	0.874	A0A3B3ISQ4_HUMAN EPS8 like 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=1
2	Q99K30	0.0	1215	729	0.859	0.842	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
3	Q9H6S3	0.0	1470	715	1.000	1.000	ES8L2_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2
4	Q12929	2.48e-179	534	822	0.452	0.393	EPS8_HUMAN Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 PE=1 SV=1
5	F1M3L7	3.75e-146	448	822	0.369	0.321	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
6	Q08509	1.51e-143	442	821	0.362	0.315	EPS8_MOUSE Epidermal growth factor receptor kinase substrate 8 OS=Mus musculus OX=10090 GN=Eps8 PE=1 SV=2
7	Q8TE68	1.08e-140	431	723	0.414	0.409	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
8	Q8TE67	2.67e-68	237	593	0.291	0.351	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
9	G5EFE0	4.12e-48	183	740	0.183	0.177	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
10	G5ED33	2.26e-47	182	917	0.183	0.143	G5ED33_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant A OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
11	O18250	3.27e-47	182	862	0.186	0.154	O18250_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=3
12	Q7YTG1	4.66e-47	181	845	0.186	0.157	Q7YTG1_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
13	Q9U3Z9	9.55e-40	159	778	0.122	0.112	Q9U3Z9_DROME Arouser OS=Drosophila melanogaster OX=7227 GN=aru PE=2 SV=1
14	Q9VPU7	9.55e-40	159	778	0.122	0.112	Q9VPU7_DROME Arouser, isoform C OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
15	Q8IPW1	1.20e-39	159	805	0.122	0.108	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
16	Q7YTG2	4.19e-34	140	665	0.113	0.122	Q7YTG2_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
17	Q8T8Q9	2.16e-09	60.8	251	0.055	0.155	Q8T8Q9_DROME SD03278p OS=Drosophila melanogaster OX=7227 GN=aru PE=2 SV=1
18	Q9VPU1	2.12e-06	53.5	548	0.029	0.038	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
19	Q24218	2.99e-06	52.8	410	0.029	0.051	Q24218_DROME SH2/SH3 adaptor protein OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
20	Q8IPW2	3.15e-06	52.4	410	0.029	0.051	Q8IPW2_DROME Dreadlocks, isoform A OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	0.018	26.5	Phosphotyrosine interaction domain (PTB/PID)
2	PF08416 PTB	3.2e-47	171.3	Phosphotyrosine-binding domain
3	PF18016 SAM_3	2.7e-19	80.2	SAM domain (Sterile alpha motif)
4	PF02198 SAM_PNT	3.2e+02	12.7	Sterile alpha motif (SAM)/Pointed domain
5	PF00018 SH3_1	1.4e-07	42.3	SH3 domain
6	PF07653 SH3_2	0.068	24.3	Variant SH3 domain
7	PF08239 SH3_3	8.4	18.2	Bacterial SH3 domain
8	PF14604 SH3_9	0.0004	31.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321691	0.769	Glutamine amidotransferase-like class 1 domain-containing protein 1
2	9606.ENSP00000351118	0.760	Cadherin-related family member 5
3	9606.ENSP00000484492	0.758	Uncharacterized protein C8orf59
4	9606.ENSP00000205890	0.744	Unconventional myosin-XV
5	9606.ENSP00000367408	0.741	Peripheral plasma membrane protein CASK
6	9606.ENSP00000316891	0.719	LIM and calponin homology domains 1
7	9606.ENSP00000367059	0.706	Espin
8	9606.ENSP00000416787	0.682	Polypeptide N-acetylgalactosaminyltransferase 11
9	9606.ENSP00000365312	0.669	Abl interactor 1
10	9606.ENSP00000371846	0.664	Deformed epidermal autoregulatory factor 1 homolog
11	9606.ENSP00000387784	0.622	Son of sevenless homolog 1
12	9606.ENSP00000303908	0.603	Twinfilin-2
13	9606.ENSP00000386213	0.580	Myosin-IIIb
14	9606.ENSP00000354623	0.566	Whirlin
15	9606.ENSP00000176183	0.554	Dopamine receptor D4
16	9606.ENSP00000265944	0.527	Myosin-IIIa
17	9606.ENSP00000222644	0.512	MAGUK p55 subfamily member 6
18	9606.ENSP00000339115	0.502	Espin-like protein
19	9606.ENSP00000428182	0.501	MAGUK p55 subfamily member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.997	cytoskeletal protein binding
GO:0003779	0.970	actin binding
GO:0050839	0.968	cell adhesion molecule binding
GO:0030234	0.967	enzyme regulator activity
GO:0045296	0.961	cadherin binding
GO:0005085	0.939	guanyl-nucleotide exchange factor activity
GO:0044877	0.914	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0007264	0.969	small GTPase mediated signal transduction
GO:0048583	0.932	regulation of response to stimulus
GO:0007265	0.912	Ras protein signal transduction
GO:0048518	0.905	positive regulation of biological process
GO:0051128	0.900	regulation of cellular component organization
GO:0048522	0.896	positive regulation of cellular process
GO:0044087	0.824	regulation of cellular component biogenesis
GO:0032501	0.802	multicellular organismal process
GO:0031344	0.757	regulation of cell projection organization
GO:0007266	0.738	Rho protein signal transduction
GO:0051056	0.716	regulation of small GTPase mediated signal transduction
GO:0060491	0.623	regulation of cell projection assembly
GO:0051130	0.481	positive regulation of cellular component organization
GO:0035023	0.474	regulation of Rho protein signal transduction
GO:0120035	0.452	regulation of plasma membrane bounded cell projection organization
GO:0031346	0.434	positive regulation of cell projection organization
GO:0050877	0.429	nervous system process
GO:0120034	0.423	positive regulation of plasma membrane bounded cell projection assembly
GO:0007605	0.396	sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005829	0.999	cytosol
GO:0032991	0.992	protein-containing complex
GO:0042995	0.988	cell projection
GO:0043227	0.988	membrane-bounded organelle
GO:0005886	0.988	plasma membrane
GO:0005576	0.983	extracellular region
GO:0120025	0.952	plasma membrane bounded cell projection
GO:0070062	0.934	extracellular exosome
GO:0043229	0.888	intracellular organelle
GO:0098858	0.681	actin-based cell projection
GO:0043231	0.614	intracellular membrane-bounded organelle
GO:0031252	0.433	cell leading edge
GO:0098590	0.415	plasma membrane region
GO:0031253	0.391	cell projection membrane
GO:0098862	0.364	cluster of actin-based cell projections
GO:0032587	0.343	ruffle membrane
GO:0032420	0.327	stereocilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]