StarFunc result for job id Q9H6U6

User Input

>input (928 residues)
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKI
VWVRFENADLNDTSRNLEFHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRH
GPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLYSLRTGEMVKS
IQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWL
AYAENKLIRCHQSRGGACGDNIQSYTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTE
DDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWV
VVSTLRGTSHVFPINPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCS
PVPGLSSSPSGSPLHGKLNSQDSYNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPYLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKR
EKDQSKQVVVESLYIISCYGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTP
QWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDF
DTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWP
EGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGS
IPRNFDGYRSPLPTNESQPLSLFPTGFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CCN5	0.843	0.843	0.000	928	0.968	0.968	Q8CCN5.pdb.gz	BCAS3_MOUSE BCAS3 microtubule associated cell migration factor OS=Mus musculus OX=10090 GN=Bcas3 PE=1 SV=2
2	PDB:6kybB	0.301	0.790	5.515E-18	330	0.077	0.215	6kybB.pdb.gz
3	PDB:6iyyA	0.271	0.749	4.564E-14	312	0.078	0.231	6iyyA.pdb.gz
4	PDB:7qdrC	0.224	0.611	2.651E-11	305	0.052	0.157	7qdrC.pdb.gz
5	PDB:7mq8LO	0.133	0.143	1.558E-10	848	0.046	0.051	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7kxtA	0.184	0.374	1.740E-10	365	0.054	0.137	7kxtA.pdb.gz	Structure-Guided Development of Small-Molecule PRC2 Inhibitors Targeting EZH2-EED Interaction.
7	PDB:5mzhB	0.204	0.413	5.563E-10	415	0.055	0.123	5mzhB.pdb.gz
8	PDB:7mq8LR	0.120	0.143	5.563E-10	773	0.042	0.050	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7mq8LN	0.123	0.165	6.942E-10	671	0.042	0.058	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7ajtUA	0.182	0.201	1.023E-9	834	0.042	0.047	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:7mq8LT	0.102	0.108	1.023E-9	869	0.060	0.064	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:M9PHU0	0.239	0.108	2.038E-8	2263	0.133	0.054	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
13	AFDB:Q8I5B3	0.207	0.232	2.840E-8	822	0.108	0.122	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
14	AFDB:F4HTH8	0.189	0.152	1.414E-7	1181	0.116	0.091	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
15	AFDB:P25365	0.214	0.190	6.299E-7	1065	0.115	0.100	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
16	AFDB:Q9C0J8	0.200	0.144	1.096E-6	1336	0.130	0.091	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
17	AFDB:Q389F7	0.184	0.159	2.176E-5	1105	0.121	0.101	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
18	AFDB:Q9VC96	0.189	0.088	3.032E-5	2232	0.125	0.052	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
19	AFDB:Q6NRD3	0.043	0.046	1.925E-3	826	0.102	0.115	Q6NRD3.pdb.gz	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
20	AFDB:A8WIP5	0.121	0.065	1.967E-2	1993	0.131	0.061	A8WIP5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CCN5	0.0	1871	928	0.969	0.969	BCAS3_MOUSE BCAS3 microtubule associated cell migration factor OS=Mus musculus OX=10090 GN=Bcas3 PE=1 SV=2
2	Q9H6U6	0.0	1919	928	1.000	1.000	BCAS3_HUMAN BCAS3 microtubule associated cell migration factor OS=Homo sapiens OX=9606 GN=BCAS3 PE=1 SV=3
3	Q8SY41	6.31e-137	439	1122	0.356	0.294	BCAS3_DROME Breast carcinoma-amplified sequence 3 homolog OS=Drosophila melanogaster OX=7227 GN=rudhira PE=1 SV=1
4	Q9FH32	2.85e-39	159	763	0.124	0.151	AT18F_ARATH Autophagy-related protein 18f OS=Arabidopsis thaliana OX=3702 GN=ATG18F PE=2 SV=1
5	Q8H1Q5	3.16e-37	153	927	0.135	0.135	AT18H_ARATH Autophagy-related protein 18h OS=Arabidopsis thaliana OX=3702 GN=ATG18H PE=2 SV=1
6	Q8GUL1	9.18e-35	145	959	0.129	0.125	AT18G_ARATH Autophagy-related protein 18g OS=Arabidopsis thaliana OX=3702 GN=ATG18G PE=2 SV=1
7	Q559F5	1.64e-19	97.1	1209	0.069	0.053	Q559F5_DICDI BCAS3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272949 PE=4 SV=1
8	O16466	4.97e-05	49.3	412	0.031	0.070	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
9	P43601	6.44e-05	48.9	500	0.067	0.124	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
10	Q93VB2	0.001	44.7	425	0.026	0.056	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
11	Q9HDZ7	0.002	44.3	373	0.029	0.072	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
12	Q54SA0	0.005	42.4	350	0.036	0.094	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
13	Q5MNZ6	0.016	41.2	344	0.029	0.078	WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2
14	Q9Y4P8	0.067	39.3	454	0.033	0.068	WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1
15	Q86MP3	0.075	38.9	388	0.029	0.070	EPG6_CAEEL Ectopic P granules protein 6 OS=Caenorhabditis elegans OX=6239 GN=epg-6 PE=1 SV=1
16	Q80W47	0.17	37.7	445	0.032	0.067	WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus OX=10090 GN=Wipi2 PE=1 SV=1
17	Q9Y484	0.19	37.7	360	0.024	0.061	WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens OX=9606 GN=WDR45 PE=1 SV=1
18	Q8R3E3	0.36	37.0	446	0.038	0.078	WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus OX=10090 GN=Wipi1 PE=1 SV=1
19	Q6NKX1	0.72	35.8	476	0.023	0.044	PROD2_ARATH Proline dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX2 PE=1 SV=1
20	Q5MNZ9	0.87	35.8	446	0.029	0.061	WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens OX=9606 GN=WIPI1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12490 BCAS3	3.5e-20	84.2	Breast carcinoma amplified sequence 3
2	PF20233 DUF6590	3.9e+02	12.4	Family of unknown function (DUF6590)
3	PF00400 WD40	4.6	19.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375067

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288828	0.909	WD repeat domain phosphoinositide-interacting protein 2
2	9606.ENSP00000351642	0.909	Belongs to the cappuccino family
3	9606.ENSP00000219139	0.884	UPF0183 protein C16orf70
4	9606.ENSP00000319918	0.708	T-cell immunomodulatory protein
5	9606.ENSP00000240328	0.695	T-box transcription factor TBX2
6	9606.ENSP00000356297	0.691	Pleckstrin homology and RhoGEF domain containing G1
7	9606.ENSP00000379267	0.681	Elongator complex protein 4
8	9606.ENSP00000357973	0.679	AFG1-like ATPase
9	9606.ENSP00000323527	0.668	Muskelin
10	9606.ENSP00000333633	0.665	Metastasis-associated protein MTA1
11	9606.ENSP00000386710	0.647	Autophagy-related protein 9A
12	9606.ENSP00000446278	0.639	Leucine rich repeats and transmembrane domains 2
13	9606.ENSP00000304670	0.636	E3 ubiquitin-protein ligase RNFT1
14	9606.ENSP00000301396	0.616	Proline-, glutamic acid- and leucine-rich protein 1
15	9606.ENSP00000184956	0.602	HEAT repeat-containing protein 6
16	9606.ENSP00000299155	0.602	Protein amnionless
17	9606.ENSP00000478070	0.602	CWC25 spliceosome associated protein homolog
18	9606.ENSP00000240335	0.598	T-box transcription factor TBX4
19	9606.ENSP00000427211	0.597	Amyloid-beta A4 precursor protein-binding family B member 2
20	9606.ENSP00000328327	0.590	Ankyrin repeat and SOCS box protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.962	lipid binding
GO:0019899	0.736	enzyme binding
GO:0005543	0.723	phospholipid binding
GO:0035091	0.607	phosphatidylinositol binding
GO:0098772	0.495	molecular function regulator activity
GO:0140297	0.466	DNA-binding transcription factor binding
GO:0030234	0.442	enzyme regulator activity
GO:0061629	0.421	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140677	0.363	molecular function activator activity
GO:0003682	0.363	chromatin binding
GO:0008092	0.352	cytoskeletal protein binding
GO:0016922	0.339	nuclear receptor binding
GO:0042393	0.312	histone binding
GO:0008047	0.305	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048522	0.979	positive regulation of cellular process
GO:0009889	0.968	regulation of biosynthetic process
GO:0050896	0.953	response to stimulus
GO:0019219	0.947	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.943	regulation of cellular biosynthetic process
GO:0010468	0.941	regulation of gene expression
GO:0010556	0.940	regulation of macromolecule biosynthetic process
GO:0051716	0.937	cellular response to stimulus
GO:0044093	0.927	positive regulation of molecular function
GO:0051252	0.917	regulation of RNA metabolic process
GO:0042221	0.901	response to chemical
GO:0006355	0.900	regulation of DNA-templated transcription
GO:0043085	0.892	positive regulation of catalytic activity
GO:0009893	0.884	positive regulation of metabolic process
GO:0010604	0.868	positive regulation of macromolecule metabolic process
GO:0031328	0.832	positive regulation of cellular biosynthetic process
GO:0045935	0.820	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.783	positive regulation of macromolecule biosynthetic process
GO:0006357	0.734	regulation of transcription by RNA polymerase II
GO:0051254	0.725	positive regulation of RNA metabolic process
GO:0043627	0.721	response to estrogen
GO:0070887	0.695	cellular response to chemical stimulus
GO:0032870	0.681	cellular response to hormone stimulus
GO:1903508	0.675	positive regulation of nucleic acid-templated transcription
GO:0045893	0.671	positive regulation of DNA-templated transcription
GO:0071840	0.604	cellular component organization or biogenesis
GO:0016043	0.585	cellular component organization
GO:0048519	0.572	negative regulation of biological process
GO:0071391	0.512	cellular response to estrogen stimulus
GO:0045944	0.457	positive regulation of transcription by RNA polymerase II
GO:0048523	0.451	negative regulation of cellular process
GO:0051128	0.374	regulation of cellular component organization
GO:0008152	0.327	metabolic process
GO:0032879	0.316	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0043227	0.996	membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0071944	0.991	cell periphery
GO:0005829	0.955	cytosol
GO:0016020	0.802	membrane
GO:0031981	0.796	nuclear lumen
GO:0005654	0.769	nucleoplasm
GO:0005856	0.718	cytoskeleton
GO:0015630	0.690	microtubule cytoskeleton
GO:0000785	0.585	chromatin
GO:0005886	0.553	plasma membrane
GO:0012505	0.482	endomembrane system
GO:0099080	0.481	supramolecular complex
GO:0099512	0.449	supramolecular fiber
GO:0099513	0.427	polymeric cytoskeletal fiber
GO:0005874	0.415	microtubule
GO:0032991	0.386	protein-containing complex
GO:0031252	0.369	cell leading edge
GO:0000791	0.317	euchromatin
GO:0000407	0.309	phagophore assembly site

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]