StarFunc result for job id Q9H6W3

User Input

>input (641 residues)
MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPS
ENSEESRVESTADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSA
RLVPASAPPARLVEVPAAPVRVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPA
WDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRRLWEREAVLVRRQDHTYYQG
LFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLC
PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVY
RPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTL
STYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEK
VRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGA
QLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLG
SYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H6W3	1.000	1.000	0.000	641	1.000	1.000	Q9H6W3.pdb.gz	RIOX1_HUMAN Ribosomal oxygenase 1 OS=Homo sapiens OX=9606 GN=RIOX1 PE=1 SV=2
2	AFDB:Q7K4H4	0.668	0.656	1.755E-53	653	0.334	0.328	Q7K4H4.pdb.gz	NO66_DROME Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Drosophila melanogaster OX=7227 GN=NO66 PE=1 SV=1
3	AFDB:O01658	0.641	0.552	1.215E-44	748	0.278	0.238	O01658.pdb.gz	NO66_CAEEL Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Caenorhabditis elegans OX=6239 GN=jmjc-1 PE=3 SV=2
4	PDB:4bxfA	0.535	0.779	1.933E-34	425	0.222	0.334	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
5	PDB:4bu2A	0.488	0.795	1.840E-29	379	0.211	0.356	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
6	PDB:4cclB	0.339	0.521	7.499E-15	372	0.109	0.188	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
7	PDB:4b7eA	0.218	0.369	4.185E-8	349	0.092	0.169	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
8	PDB:4qszA	0.232	0.219	8.860E-8	686	0.070	0.066	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
9	PDB:3al5C	0.225	0.451	1.435E-7	284	0.073	0.165	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
10	PDB:5nfnB	0.210	0.386	2.587E-7	318	0.067	0.135	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
11	PDB:3al5B	0.229	0.425	4.919E-7	311	0.066	0.135	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:7yxgA	0.245	0.460	8.868E-7	313	0.061	0.125	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
13	PDB:1fxzA	0.144	0.240	8.419E-5	371	0.048	0.084	1fxzA.pdb.gz
14	AFDB:Q69ZK6	0.231	0.072	1.830E-4	2350	0.094	0.026	Q69ZK6.pdb.gz	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
15	AFDB:A0A0R4IH56	0.223	0.120	6.620E-4	1295	0.070	0.035	A0A0R4IH56.pdb.gz	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
16	AFDB:Q15652	0.231	0.069	2.394E-3	2540	0.101	0.026	Q15652.pdb.gz	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
17	AFDB:O57392	0.102	0.077	4.804E-3	872	0.070	0.052	O57392.pdb.gz	O57392_CHICK CENP-C OS=Gallus gallus OX=9031 GN=centoromere protein C PE=2 SV=1
18	AFDB:Q80T69	0.209	0.176	2.272E-2	795	0.111	0.089	Q80T69.pdb.gz	RSBN1_MOUSE Lysine-specific demethylase 9 OS=Mus musculus OX=10090 GN=Rsbn1 PE=1 SV=3
19	AFDB:A0A1D8PHH2	0.059	0.047	2.397E-2	983	0.069	0.045	A0A1D8PHH2.pdb.gz	A0A1D8PHH2_CANAL Png2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PNG2 PE=4 SV=1
20	AFDB:A0A0G2JV04	0.074	0.067	8.216E-2	727	0.094	0.083	A0A0G2JV04.pdb.gz	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H6W3	0.0	1301	641	1.000	1.000	RIOX1_HUMAN Ribosomal oxygenase 1 OS=Homo sapiens OX=9606 GN=RIOX1 PE=1 SV=2
2	Q9JJF3	0.0	920	603	0.750	0.798	RIOX1_MOUSE Ribosomal oxygenase 1 OS=Mus musculus OX=10090 GN=Riox1 PE=1 SV=2
3	Q7K4H4	3.88e-114	358	653	0.281	0.276	NO66_DROME Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Drosophila melanogaster OX=7227 GN=NO66 PE=1 SV=1
4	O01658	3.41e-84	281	748	0.250	0.214	NO66_CAEEL Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Caenorhabditis elegans OX=6239 GN=jmjc-1 PE=3 SV=2
5	Q8CFC1	9.16e-66	225	465	0.253	0.348	RIOX2_RAT Ribosomal oxygenase 2 OS=Rattus norvegicus OX=10116 GN=Riox2 PE=2 SV=1
6	Q8IUF8	4.21e-65	223	465	0.236	0.325	RIOX2_HUMAN Ribosomal oxygenase 2 OS=Homo sapiens OX=9606 GN=RIOX2 PE=1 SV=1
7	Q8CD15	1.21e-64	222	465	0.251	0.346	RIOX2_MOUSE Ribosomal oxygenase 2 OS=Mus musculus OX=10090 GN=Riox2 PE=1 SV=2
8	P27431	7.05e-06	51.2	373	0.044	0.075	ROXA_ECOLI Ribosomal protein uL16 3-hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=roxA PE=1 SV=2
9	Q9VB06	0.046	38.9	398	0.041	0.065	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3
10	Q96EW2	0.16	37.4	488	0.041	0.053	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
11	Q9CXT6	0.18	37.0	414	0.048	0.075	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
12	A0A0S2Z5T1	0.42	35.8	416	0.042	0.065	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
13	Q8N371	0.42	35.8	416	0.042	0.065	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
14	P84791	2.5	32.3	141	0.019	0.085	HBAD_AYTFU Hemoglobin subunit alpha-D OS=Aythya fuligula OX=219594 GN=HBAD PE=1 SV=1
15	Q9H9V9	4.7	32.7	463	0.059	0.082	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
16	Q9HTQ2	6.3	32.0	357	0.036	0.064	ALR2_PSEAE Alanine racemase, catabolic OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dadX PE=1 SV=1
17	Q67ZB6	7.4	32.0	462	0.039	0.054	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
18	Q38DD6	8.8	32.0	1145	0.033	0.018	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
19	Q10078	9.0	31.6	344	0.022	0.041	PPK13_SCHPO Serine/threonine-protein kinase ppk13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk13 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00190 Cupin_1	99	14.0	Cupin
2	PF07883 Cupin_2	2.9e+02	12.6	Cupin domain
3	PF13621 Cupin_8	0.019	26.4	Cupin-like domain
4	PF08007 JmjC_2	2.2e-34	129.1	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262584	0.978	60S ribosomal protein L8
2	9606.ENSP00000483946	0.978	PHD finger protein 19
3	9606.ENSP00000443827	0.943	Transcription factor Sp7
4	9606.ENSP00000398410	0.823	JmjC domain-containing protein 5
5	9606.ENSP00000380467	0.810	JmjC domain-containing protein 7
6	9606.ENSP00000346627	0.740	tRNA wybutosine-synthesizing protein 5
7	9606.ENSP00000302562	0.711	HSPB1-associated protein 1
8	9606.ENSP00000355720	0.681	JmjC domain-containing protein 4
9	9606.ENSP00000457258	0.671	Prolyl 3-hydroxylase OGFOD1
10	9606.ENSP00000399475	0.654	JmjC domain-containing protein 8
11	9606.ENSP00000366271	0.650	Lysine-specific demethylase 2B
12	9606.ENSP00000363583	0.645	Ras-GEF domain-containing family member 1A
13	9606.ENSP00000369162	0.645	Serine/threonine-protein kinase RIO1
14	9606.ENSP00000387361	0.645	Strawberry notch homolog 1
15	9606.ENSP00000377027	0.635	Transforming growth factor-beta receptor-associated protein 1
16	9606.ENSP00000432786	0.615	Lysine-specific demethylase 2A
17	9606.ENSP00000346015	0.612	Ribosomal protein L27a
18	9606.ENSP00000159111	0.600	Lysine-specific demethylase 4B
19	9606.ENSP00000361473	0.600	Lysine-specific demethylase 4A
20	9606.ENSP00000380544	0.595	2-oxoglutarate and iron dependent oxygenase domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140457	1.000	protein demethylase activity
GO:0016706	1.000	2-oxoglutarate-dependent dioxygenase activity
GO:0036139	0.952	peptidyl-histidine dioxygenase activity
GO:0043167	0.479	ion binding
GO:0043169	0.463	cation binding
GO:0032452	0.458	histone demethylase activity
GO:0046914	0.429	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0010468	0.995	regulation of gene expression
GO:0050794	0.989	regulation of cellular process
GO:0048519	0.986	negative regulation of biological process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0080090	0.979	regulation of primary metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.971	regulation of macromolecule biosynthetic process
GO:0031326	0.971	regulation of cellular biosynthetic process
GO:0071840	0.957	cellular component organization or biogenesis
GO:2001141	0.940	regulation of RNA biosynthetic process
GO:0048523	0.924	negative regulation of cellular process
GO:1903506	0.892	regulation of nucleic acid-templated transcription
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0010605	0.741	negative regulation of macromolecule metabolic process
GO:0016043	0.691	cellular component organization
GO:0010558	0.569	negative regulation of macromolecule biosynthetic process
GO:0031327	0.559	negative regulation of cellular biosynthetic process
GO:0051172	0.555	negative regulation of nitrogen compound metabolic process
GO:0050793	0.469	regulation of developmental process
GO:0045892	0.446	negative regulation of DNA-templated transcription
GO:0006325	0.443	chromatin organization
GO:0045667	0.395	regulation of osteoblast differentiation
GO:0044085	0.356	cellular component biogenesis
GO:0051093	0.326	negative regulation of developmental process
GO:0006338	0.325	chromatin remodeling
GO:0045668	0.309	negative regulation of osteoblast differentiation
GO:0022613	0.306	ribonucleoprotein complex biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	0.999	nucleolus
GO:0005654	0.969	nucleoplasm
GO:0005737	0.722	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]