StarFunc result for job id Q9H6Y5

User Input

>input (334 residues)
MEPRTGDAADPRGSRGGRGPSPLAGPSARQLLARLDARPLAARAAVDVAALVRRAGATLR
LRRKEAVSVLDSADIEVTDSRLPHATIVDHRPQHRWLETCNAPPQLIQGKARSAPKPSQA
SGHFSVELVRGYAGFGLTLGGGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDLVLHINGE
STQGLTHAQAVERIRAGGPQLHLVIRRPLETHPGKPRGVGEPRKGVVPSWPDRSPDPGGP
EVTGSRSSSTSLVQHPPSRTTLKKTRGSPEPSPEAAADGPTVSPPERRAEDPNDQIPGSP
GPWLVPSEERLSRALGVRGAAQLAQEMAAGRRRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RHR9	0.265	0.063	3.255E-12	1471	0.195	0.044	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
2	AFDB:A0A087WT53	0.269	0.082	5.626E-12	1155	0.222	0.064	A0A087WT53.pdb.gz	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	AFDB:Q96QZ7	0.253	0.058	1.898E-11	1491	0.207	0.046	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
4	AFDB:P31007	0.254	0.092	3.936E-11	970	0.186	0.064	P31007.pdb.gz	DLG1_DROME Disks large 1 tumor suppressor protein OS=Drosophila melanogaster OX=7227 GN=dlg1 PE=1 SV=2
5	AFDB:H7C5T8	0.263	0.089	1.500E-10	1014	0.162	0.053	H7C5T8.pdb.gz	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
6	AFDB:F1NMZ1	0.272	0.076	1.594E-10	1256	0.165	0.044	F1NMZ1.pdb.gz
7	AFDB:E0CXS4	0.249	0.086	3.513E-10	1001	0.189	0.063	E0CXS4.pdb.gz	E0CXS4_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
8	AFDB:Q9WTW1	0.253	0.085	2.313E-9	1043	0.195	0.062	Q9WTW1.pdb.gz	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
9	AFDB:Q5WRR6	0.255	0.168	2.776E-9	515	0.120	0.078	Q5WRR6.pdb.gz	Q5WRR6_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=stn-2 PE=1 SV=1
10	AFDB:Q9Y3R0	0.228	0.069	3.540E-9	1128	0.162	0.048	Q9Y3R0.pdb.gz	GRIP1_HUMAN Glutamate receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=GRIP1 PE=1 SV=3
11	PDB:7pc3A	0.249	0.207	7.854E-9	405	0.069	0.057	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p73A	0.241	0.193	4.580E-8	420	0.084	0.067	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:5n7dA	0.252	0.201	1.368E-7	423	0.096	0.076	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
14	PDB:7p70A	0.254	0.209	4.904E-7	407	0.066	0.054	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:6t36A	0.244	0.843	7.063E-7	93	0.090	0.323	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7qqmA	0.246	0.201	1.149E-6	413	0.087	0.070	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7qqnC	0.230	0.186	1.654E-6	414	0.078	0.063	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7pc5A	0.242	0.201	1.868E-6	405	0.066	0.054	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:2xkxA	0.248	0.119	2.110E-6	721	0.072	0.033	2xkxA.pdb.gz
20	PDB:7pcbA	0.237	0.192	3.039E-6	415	0.084	0.067	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WT53	2.12e-22	100	1155	0.186	0.054	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
2	Q96QZ7	2.40e-22	100	1491	0.186	0.042	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
3	H7C4U7	3.30e-22	100	1131	0.186	0.055	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
4	H7C5T8	4.15e-22	99.8	1014	0.186	0.061	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
5	Q6RHR9	4.56e-22	99.8	1471	0.177	0.040	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
6	H7C535	4.94e-22	99.4	1136	0.186	0.055	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	A0A087WXD2	7.12e-22	99.0	980	0.186	0.063	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
8	A0A8I3NPD4	2.65e-21	97.4	1398	0.180	0.043	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
9	F1Q897	9.76e-18	86.7	1503	0.126	0.028	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
10	Q9WVQ1	1.12e-17	86.3	1275	0.141	0.037	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
11	O88382	1.17e-17	86.3	1277	0.141	0.037	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
12	Q86UL8	4.40e-17	84.7	1455	0.120	0.027	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
13	Q5F488	2.46e-16	82.4	1128	0.129	0.038	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
14	Q9JK71	3.90e-16	82.0	1470	0.126	0.029	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
15	Q9EQJ9	1.01e-15	80.5	1476	0.123	0.028	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
16	Q5TCQ9	1.40e-15	80.1	1481	0.123	0.028	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
17	Q9WVJ4	1.28e-10	60.8	145	0.114	0.262	SYJ2B_RAT Synaptojanin-2-binding protein OS=Rattus norvegicus OX=10116 GN=Synj2bp PE=1 SV=2
18	Q5WRR6	1.94e-10	63.9	515	0.081	0.052	Q5WRR6_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=stn-2 PE=1 SV=1
19	C1P634	4.43e-10	63.2	855	0.108	0.042	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
20	D3YT29	4.88e-10	63.2	829	0.096	0.039	D3YT29_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	3e-10	51.6	PDZ domain
2	PF13180 PDZ_2	1.3e+02	14.4	PDZ domain
3	PF17820 PDZ_6	9.3e-07	40.0	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325929	0.611	Ligand of numb-protein X 2
2	9606.ENSP00000349016	0.610	Peroxisomal membrane protein PEX14
3	9606.ENSP00000390590	0.537	Dendrin
4	9606.ENSP00000394394	0.526	Anaphase-promoting complex subunit 7
5	9606.ENSP00000480489	0.510	PDZ domain-containing protein 7
6	9606.ENSP00000314004	0.509	Anaphase-promoting complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.929	cellular process
GO:0065007	0.927	biological regulation
GO:0032501	0.822	multicellular organismal process
GO:0050789	0.630	regulation of biological process
GO:0050794	0.574	regulation of cellular process
GO:0032502	0.417	developmental process
GO:0048856	0.412	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005622	0.987	intracellular anatomical structure
GO:0043226	0.949	organelle
GO:0005737	0.948	cytoplasm
GO:0005829	0.929	cytosol
GO:0043227	0.926	membrane-bounded organelle
GO:0016020	0.922	membrane
GO:0043229	0.918	intracellular organelle
GO:0071944	0.916	cell periphery
GO:0005634	0.844	nucleus
GO:0005886	0.733	plasma membrane
GO:0030054	0.576	cell junction
GO:0005654	0.359	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]