StarFunc result for job id Q9H706

User Input

>input (876 residues)
MDPAPSLGCSLKDVKWSSVAVPLDLLVSTYRLPQIARLDNGECVEGLRENDYLLIHSCRQ
WTTITAHSLEEGHYVIGPKIEIPVHYAGQFKLLEQDRDIKEPVQYFNSVEEVAKAFPERV
YVMEDITFNVKVASGECNEDTEVYNITLCTGDELTLMGQAEILYAKTFKEKSRLNTIFKK
IGKLNSISKLGKGKMPCLICMNHRTNESISLPFQCKGRFSTRSPLELQMQEGEHTIRNIV
EKTRLPVNVTVPSPPPRNPYDLHFIREGHRYKFVNIQTKTVVVCCVLRNNKILPMHFPLH
LTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKG
RCSGHNHVPNSLSYARDELTQSFHRLSVCVYGNNLHGNSEVNLHGCRDLGGDWAPFPHDI
LPYQDSGDSGSDYLFPEASEESAGIPGKSELPYEELWLEEGKPSHQPLTRSLSEKNRCDQ
FRGSVRSKCATSPLPIPGTLGAAVKSSDTALPPPPVPPKSEAVREECRLLNAPPVPPRSA
KPLSTSPSIPPRTVKPARQQTRSPSPTLSYYSSGLHNISVTKTDTNPSESTPVSCYPCNR
VKTDSVDLKSPFGSPSAEAVSSRLSWPNHYSGASESQTRSDFLLDPSRSYSYPRQKTPGT
PKRNCPAPFDFDGCELLASPTSPVTAEFSSSVSGCPKSASYSLESTDVKSLAAGVTKQST
SCPALPPRAPKLVEEKVASETSPLPLKIDGAEEDPKSGSPDLSEDQYFVKKGMQDIFSAS
YPFSSPLHLQLAPRSCGDGSPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDG
NLLVQLTEEILSEDFKLSKLQVKKIMQFINGWRPKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H706	1.000	1.000	0.000	876	1.000	1.000	Q9H706.pdb.gz	GARE1_HUMAN GRB2-associated and regulator of MAPK protein 1 OS=Homo sapiens OX=9606 GN=GAREM1 PE=1 SV=2
2	AFDB:Q6NLM8	0.190	0.211	7.775E-12	778	0.158	0.177	Q6NLM8.pdb.gz	Q6NLM8_DROME RE56731p OS=Drosophila melanogaster OX=7227 GN=sano PE=2 SV=1
3	PDB:6hiwDB	0.038	0.031	8.121E-3	1111	0.039	0.031	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
4	AFDB:Q57WH0	0.054	0.045	1.011E-2	1241	0.150	0.106	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
5	AFDB:Q9JLU4	0.079	0.043	2.093E-2	1740	0.179	0.090	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
6	PDB:6brhB	0.072	0.125	2.942E-2	502	0.025	0.044	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
7	AFDB:G5EBF1	0.050	0.042	3.275E-2	1273	0.114	0.079	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
8	AFDB:A0A1D5NXF3	0.040	0.046	3.463E-2	732	0.126	0.150	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
9	PDB:7anwA	0.077	0.103	4.352E-2	645	0.024	0.033	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
10	PDB:3upuA	0.059	0.102	5.758E-2	439	0.014	0.027	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
11	AFDB:D3YZU1	0.073	0.032	6.410E-2	2167	0.122	0.049	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
12	AFDB:Q5QNQ9	0.044	0.034	7.169E-2	1845	0.126	0.060	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
13	PDB:6wpkA	0.077	0.121	7.202E-2	547	0.024	0.038	6wpkA.pdb.gz
14	PDB:5an9A	0.039	0.064	7.617E-2	398	0.039	0.085	5an9A.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
15	AFDB:A0A0A1I9R6	0.038	0.036	9.484E-2	1245	0.123	0.087	A0A0A1I9R6.pdb.gz
16	PDB:3bs5A	0.071	0.621	9.528E-2	86	0.015	0.151	3bs5A.pdb.gz
17	PDB:7cm7A	0.072	0.100	9.528E-2	620	0.024	0.034	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
18	AFDB:A0A024R064	0.048	0.049	1.061E-1	852	0.131	0.135	A0A024R064.pdb.gz
19	PDB:3duzA	0.038	0.064	1.865E-1	418	0.035	0.074	3duzA.pdb.gz
20	PDB:6xf5A	0.048	0.043	2.206E-1	1009	0.033	0.029	6xf5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H706	0.0	1800	876	1.000	1.000	GARE1_HUMAN GRB2-associated and regulator of MAPK protein 1 OS=Homo sapiens OX=9606 GN=GAREM1 PE=1 SV=2
2	Q86DA5	1.2	35.4	981	0.024	0.021	SARM1_CAEEL NAD(+) hydrolase tir-1 OS=Caenorhabditis elegans OX=6239 GN=tir-1 PE=1 SV=2
3	Q9W4N8	2.5	33.5	269	0.022	0.071	Q9W4N8_DROME LD30122p OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
4	Q7KVX5	3.1	33.1	235	0.019	0.072	Q7KVX5_DROME VAMP-associated protein 33kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
5	P97814	7.7	32.3	415	0.032	0.067	PPIP1_MOUSE Proline-serine-threonine phosphatase-interacting protein 1 OS=Mus musculus OX=10090 GN=Pstpip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12736 CABIT	6.2e-77	270.2	Cell-cycle sustaining, positive selection,
2	PF00536 SAM_1	12	17.8	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269209

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.974	Growth factor receptor-bound protein 2
2	9606.ENSP00000363031	0.715	Protein THEMIS2
3	9606.ENSP00000340944	0.701	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000339186	0.622	GRB2-related adapter protein 2
5	9606.ENSP00000401303	0.593	SHC-transforming protein 1
6	9606.ENSP00000264335	0.544	14-3-3 protein epsilon
7	9606.ENSP00000269197	0.526	Putative Polycomb group protein ASXL3
8	9606.ENSP00000372576	0.520	Coiled-coil domain containing 178
9	9606.ENSP00000369907	0.519	Stabilizer of axonemal microtubules 1
10	9606.ENSP00000465517	0.519	UPF0711 protein C18orf21
11	9606.ENSP00000300249	0.506	Microtubule-associated protein RP/EB family member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070064	1.000	proline-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0007165	0.976	signal transduction
GO:0048522	0.967	positive regulation of cellular process
GO:0007169	0.957	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009719	0.924	response to endogenous stimulus
GO:0038127	0.917	ERBB signaling pathway
GO:0007173	0.901	epidermal growth factor receptor signaling pathway
GO:0043408	0.866	regulation of MAPK cascade
GO:0071495	0.857	cellular response to endogenous stimulus
GO:0070848	0.842	response to growth factor
GO:0070849	0.811	response to epidermal growth factor
GO:0048584	0.794	positive regulation of response to stimulus
GO:0070372	0.729	regulation of ERK1 and ERK2 cascade
GO:0071363	0.716	cellular response to growth factor stimulus
GO:0071364	0.698	cellular response to epidermal growth factor stimulus
GO:0043410	0.474	positive regulation of MAPK cascade
GO:0070374	0.457	positive regulation of ERK1 and ERK2 cascade
GO:0019222	0.364	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0016020	0.993	membrane
GO:0071944	0.983	cell periphery
GO:0005829	0.968	cytosol
GO:0005886	0.938	plasma membrane
GO:0070013	0.714	intracellular organelle lumen
GO:0043232	0.619	intracellular non-membrane-bounded organelle
GO:0031981	0.607	nuclear lumen
GO:0005654	0.499	nucleoplasm
GO:0030054	0.498	cell junction
GO:0012505	0.489	endomembrane system
GO:0032991	0.449	protein-containing complex
GO:0005856	0.384	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]