StarFunc result for job id Q9H707

User Input

>input (407 residues)
MAAAALRFPVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVE
DEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHR
CEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLL
RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQHERLLPTEEPS
VWCECGKSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSKSHLLVHQRIHTGEKPYECEV
CQKFFRHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQKPYECSECGKS
FAESSSLTKHRRVHTGEKPYGCSECEKKFRQISSLRHHQRVHKRKGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H707	1.000	1.000	1.120E-69	407	1.000	1.000	Q9H707.pdb.gz	ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens OX=9606 GN=ZNF552 PE=1 SV=2
2	AFDB:Q8TF45	0.390	0.244	3.438E-43	676	0.663	0.399	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
3	AFDB:Q8TAU3	0.256	0.186	5.161E-40	575	0.639	0.452	Q8TAU3.pdb.gz	ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens OX=9606 GN=ZNF417 PE=1 SV=2
4	AFDB:Q9Y2P7	0.404	0.288	8.323E-39	627	0.531	0.344	Q9Y2P7.pdb.gz	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
5	AFDB:Q68DI1	0.374	0.297	8.791E-38	518	0.572	0.450	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
6	AFDB:Q6P9A3	0.359	0.238	3.286E-35	640	0.467	0.297	Q6P9A3.pdb.gz	ZN549_HUMAN Zinc finger protein 549 OS=Homo sapiens OX=9606 GN=ZNF549 PE=1 SV=2
7	AFDB:Q3KQV3	0.254	0.171	2.273E-34	632	0.477	0.307	Q3KQV3.pdb.gz	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
8	AFDB:P17021	0.260	0.171	3.666E-33	662	0.428	0.263	P17021.pdb.gz	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
9	AFDB:Q6PK81	0.361	0.335	7.128E-33	442	0.447	0.412	Q6PK81.pdb.gz	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
10	AFDB:P52742	0.376	0.238	3.194E-30	658	0.354	0.219	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
11	PDB:7ad8D	0.064	0.083	2.393	280	0.074	0.107	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:4kfzB	0.070	0.135	2.542	148	0.057	0.155	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:5gm6a	0.043	0.106	2.542	123	0.061	0.203	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:5c8dE	0.051	0.070	4.380	280	0.022	0.032	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
15	PDB:4js4A	0.059	0.053	4.653	468	0.037	0.032	4js4A.pdb.gz	Crystal structures of Escherichia coli exonuclease I in complex with single-stranded DNA provide insights into the mechanism of processive digestion.
16	PDB:6ff4t	0.054	0.090	6.295	172	0.057	0.134	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:7jppB	0.081	0.102	6.295	307	0.047	0.062	7jppB.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
18	PDB:3j9zSG	0.062	0.097	6.687	178	0.047	0.107	3j9zSG.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
19	PDB:2p01A	0.074	0.086	7.104	323	0.066	0.084	2p01A.pdb.gz
20	PDB:7qo48	0.076	0.080	7.104	372	0.025	0.027	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TF45	0.0	534	676	0.663	0.399	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
2	Q9H707	0.0	841	407	1.000	1.000	ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens OX=9606 GN=ZNF552 PE=1 SV=2
3	Q8TAU3	1.70e-154	450	575	0.604	0.428	ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens OX=9606 GN=ZNF417 PE=1 SV=2
4	Q96SQ5	9.46e-154	448	575	0.587	0.416	ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens OX=9606 GN=ZNF587 PE=1 SV=1
5	Q68DI1	1.51e-153	446	518	0.575	0.452	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
6	Q9Y2P7	1.25e-142	421	627	0.536	0.348	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
7	Q68DY9	6.52e-125	372	489	0.499	0.415	ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens OX=9606 GN=ZNF772 PE=1 SV=2
8	Q9HCX3	3.52e-111	342	659	0.484	0.299	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
9	Q3KQV3	3.07e-108	333	632	0.482	0.310	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
10	Q6P9A3	9.64e-106	327	640	0.464	0.295	ZN549_HUMAN Zinc finger protein 549 OS=Homo sapiens OX=9606 GN=ZNF549 PE=1 SV=2
11	Q8IVP9	3.16e-105	318	402	0.457	0.463	ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens OX=9606 GN=ZNF547 PE=1 SV=2
12	Q3SY52	6.18e-105	320	487	0.477	0.398	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
13	Q6PK81	4.34e-102	311	442	0.450	0.414	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
14	Q96HQ0	6.31e-100	308	510	0.445	0.355	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
15	P17021	4.16e-99	311	662	0.447	0.275	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
16	P52741	3.81e-96	296	427	0.403	0.384	ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens OX=9606 GN=ZNF134 PE=1 SV=2
17	Q9C0F3	1.00e-85	270	470	0.435	0.377	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
18	Q8NCK3	4.58e-84	265	441	0.400	0.370	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
19	P17030	2.58e-81	258	456	0.410	0.366	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
20	Q8QZZ2	1.10e-80	262	635	0.398	0.255	Q8QZZ2_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=Zfp418 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	1.7e-17	74.1	KRAB box
2	PF00096 zf-C2H2	6.7e-24	94.1	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	1.1e+02	13.9	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	4e-12	56.9	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	3.4	19.1	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	0.05	25.1	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	1.4e-32	121.8	Zinc-finger double domain
8	PF12874 zf-met	0.02	26.5	Zinc-finger of C2H2 type
9	PF18439 zf_UBZ	4.6e+02	11.9	Ubiquitin-Binding Zinc Finger
10	PF09723 Zn-ribbon_8	7.4e+02	11.7	Zinc ribbon domain
11	PF17283 Zn_ribbon_SprT	6	18.3	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375582

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484056	0.514	Zinc finger CCHC-type containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.541	nucleic acid binding
GO:0003677	0.534	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.890	regulation of metabolic process
GO:0048519	0.889	negative regulation of biological process
GO:0051171	0.850	regulation of nitrogen compound metabolic process
GO:0060255	0.845	regulation of macromolecule metabolic process
GO:0031323	0.824	regulation of cellular metabolic process
GO:0019219	0.814	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.802	regulation of RNA metabolic process
GO:0009889	0.799	regulation of biosynthetic process
GO:0010468	0.795	regulation of gene expression
GO:0006355	0.791	regulation of DNA-templated transcription
GO:0048523	0.773	negative regulation of cellular process
GO:0009987	0.624	cellular process
GO:0008152	0.592	metabolic process
GO:0045892	0.590	negative regulation of DNA-templated transcription
GO:0071704	0.527	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.994	nuclear lumen
GO:0005737	0.876	cytoplasm
GO:0005654	0.845	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]