StarFunc result for job id Q9H720

User Input

>input (699 residues)
MPSLWREILLESLLGCVSWSLYHDLGPMIYYFPLQTLELTGLEGFSIAFLSPIFLTITPF
WKLVNKKWMLTLLRIITIGSIASFQAPNAKLRLMVLALGVSSSLIVQAVTWWSGSHLQRY
LRIWGFILGQIVLVVLRIWYTSLNPIWSYQMSNKVILTLSAIATLDRIGTDGDCSKPEEK
KTGEVATGMASRPNWLLAGAAFGSLVFLTHWVFGEVSLVSRWAVSGHPHPGPDPNPFGGA
VLLCLASGLMLPSCLWFRGTGLIWWVTGTASAAGLLYLHTWAAAVSGCVFAIFTASMWPQ
TLGHLINSGTNPGKTMTIAMIFYLLEIFFCAWCTAFKFVPGGVYARERSDVLLGTMMLII
GLNMLFGPKKNLDLLLQTKNSSKVLFRKSEKYMKLFLWLLVGVGLLGLGLRHKAYERKLG
KVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFITILESDASKPYMGNNDLT
MWLGEKLGFYTDFGPSTRYHTWGIMALSRYPIVKSEHHLLPSPEGEIAPAITLTVNISGK
LVDFVVTHFGNHEDDLDRKLQAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNV
KDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVI
DHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HDZ2	0.897	0.653	8.996E-43	971	0.290	0.209	Q9HDZ2.pdb.gz	CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwh43 PE=2 SV=2
2	AFDB:P25618	0.842	0.626	1.832E-42	953	0.288	0.211	P25618.pdb.gz	CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH43 PE=1 SV=2
3	AFDB:O74369	0.267	0.427	2.666E-7	424	0.070	0.116	O74369.pdb.gz	CSS1_SCHPO Inositol phosphosphingolipids phospholipase C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=css1 PE=1 SV=2
4	AFDB:F1N588	0.264	0.299	2.899E-7	612	0.064	0.074	F1N588.pdb.gz	F1N588_BOVIN sphingomyelin phosphodiesterase OS=Bos taurus OX=9913 GN=SMPD2 PE=1 SV=2
5	AFDB:Q9ET64	0.255	0.408	3.023E-7	422	0.066	0.109	Q9ET64.pdb.gz	NSMA_RAT Sphingomyelin phosphodiesterase 2 OS=Rattus norvegicus OX=10116 GN=Smpd2 PE=1 SV=1
6	AFDB:O70572	0.263	0.422	5.431E-7	419	0.064	0.107	O70572.pdb.gz	NSMA_MOUSE Sphingomyelin phosphodiesterase 2 OS=Mus musculus OX=10090 GN=Smpd2 PE=1 SV=1
7	AFDB:A0A384MDM5	0.258	0.476	5.905E-7	362	0.066	0.127	A0A384MDM5.pdb.gz	A0A384MDM5_HUMAN Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:O60906	0.260	0.418	9.756E-7	423	0.067	0.111	O60906.pdb.gz	NSMA_HUMAN Sphingomyelin phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=SMPD2 PE=1 SV=2
9	AFDB:F1QUD7	0.262	0.422	3.283E-6	421	0.063	0.105	F1QUD7.pdb.gz	F1QUD7_DANRE sphingomyelin phosphodiesterase OS=Danio rerio OX=7955 GN=NSMase PE=3 SV=1
10	AFDB:Q9XWG3	0.236	0.434	3.722E-6	362	0.070	0.135	Q9XWG3.pdb.gz	TYDP2_CAEEL 5'-tyrosyl-DNA phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=Y63D3A.4 PE=1 SV=1
11	PDB:4f1iA	0.243	0.488	1.526E-5	328	0.073	0.155	4f1iA.pdb.gz
12	PDB:7oixB	0.259	0.361	5.135E-5	451	0.120	0.186	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
13	PDB:7ax1A	0.234	0.304	8.137E-5	518	0.066	0.089	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
14	PDB:2imqX	0.217	0.464	1.091E-4	280	0.050	0.125	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
15	PDB:1akoA	0.214	0.505	1.289E-4	268	0.040	0.104	1akoA.pdb.gz
16	PDB:7n98A	0.268	0.355	2.130E-4	473	0.103	0.152	7n98A.pdb.gz
17	PDB:6o1kA	0.225	0.544	2.221E-4	262	0.044	0.118	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
18	PDB:6oopA	0.277	0.440	3.237E-4	392	0.092	0.163	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
19	PDB:7bc7A	0.298	0.440	4.339E-4	432	0.094	0.153	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:7kiuA	0.206	0.449	4.339E-4	263	0.043	0.114	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HDZ2	1.51e-84	288	971	0.293	0.211	CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwh43 PE=2 SV=2
2	P25618	1.35e-76	266	953	0.310	0.228	CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH43 PE=1 SV=2
3	G5EBS2	6.5	32.7	1837	0.024	0.009	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
4	Q7Z002	6.5	32.7	1852	0.024	0.009	Q7Z002_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
5	Q02013	6.6	32.0	269	0.031	0.082	AQP1_MOUSE Aquaporin-1 OS=Mus musculus OX=10090 GN=Aqp1 PE=1 SV=3
6	Q7Z003	6.6	32.7	1885	0.024	0.009	Q7Z003_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
7	Q7YZR6	6.7	32.7	1844	0.024	0.009	Q7YZR6_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
8	P29975	7.3	32.0	269	0.031	0.082	AQP1_RAT Aquaporin-1 OS=Rattus norvegicus OX=10116 GN=Aqp1 PE=1 SV=4
9	A0A1D8PPC9	9.9	32.0	625	0.029	0.032	A0A1D8PPC9_CANAL Ferroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FET34 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11084 DUF2621	3.7e+02	12.5	Protein of unknown function (DUF2621)
2	PF01006 HCV_NS4a	86	14.3	Hepatitis C virus non-structural protein NS4a
3	PF15088 NADH_dh_m_C1	3.5e+02	12.2	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226432

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278243	0.742	Post-GPI attachment to proteins factor 2
2	9606.ENSP00000383392	0.704	Neural cell adhesion molecule 2
3	9606.ENSP00000262102	0.678	Microtubule-associated tumor suppressor 1
4	9606.ENSP00000474090	0.629	Uridine phosphorylase 2
5	9606.ENSP00000369559	0.602	Olfactory receptor 51I1
6	9606.ENSP00000346809	0.599	GPI inositol-deacylase
7	9606.ENSP00000300658	0.580	Post-GPI attachment to proteins factor 3
8	9606.ENSP00000315081	0.556	Leucine rich single-pass membrane protein 2
9	9606.ENSP00000357779	0.548	Cysteine rich C-terminal 1
10	9606.ENSP00000364627	0.545	NXPE family member 4
11	9606.ENSP00000357927	0.540	Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
12	9606.ENSP00000358232	0.533	Pancreatic lipase related protein 3
13	9606.ENSP00000465894	0.502	Metallophosphoesterase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	1.000	transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:0003824	0.850	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0044238	0.986	primary metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:1901564	0.983	organonitrogen compound metabolic process
GO:0044237	0.978	cellular metabolic process
GO:1901576	0.970	organic substance biosynthetic process
GO:0006643	0.967	membrane lipid metabolic process
GO:1901135	0.780	carbohydrate derivative metabolic process
GO:0019538	0.666	protein metabolic process
GO:1901566	0.639	organonitrogen compound biosynthetic process
GO:0006796	0.574	phosphate-containing compound metabolic process
GO:0008610	0.574	lipid biosynthetic process
GO:0019637	0.572	organophosphate metabolic process
GO:0036211	0.555	protein modification process
GO:1903509	0.516	liposaccharide metabolic process
GO:0006664	0.508	glycolipid metabolic process
GO:0006644	0.499	phospholipid metabolic process
GO:0065007	0.495	biological regulation
GO:0046467	0.494	membrane lipid biosynthetic process
GO:1901137	0.471	carbohydrate derivative biosynthetic process
GO:0046488	0.467	phosphatidylinositol metabolic process
GO:0050789	0.462	regulation of biological process
GO:0034645	0.462	cellular macromolecule biosynthetic process
GO:0006505	0.327	GPI anchor metabolic process
GO:0009247	0.320	glycolipid biosynthetic process
GO:0006661	0.320	phosphatidylinositol biosynthetic process
GO:0006497	0.318	protein lipidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0071944	0.995	cell periphery
GO:0005886	0.991	plasma membrane
GO:0005783	0.987	endoplasmic reticulum
GO:0031090	0.889	organelle membrane
GO:0070013	0.528	intracellular organelle lumen
GO:0005634	0.464	nucleus
GO:0031981	0.384	nuclear lumen
GO:0042175	0.360	nuclear outer membrane-endoplasmic reticulum membrane network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]