StarFunc result for job id Q9H772

User Input

>input (168 residues)
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88273	0.649	0.649	4.046E-25	168	0.952	0.952	O88273.pdb.gz	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
2	AFDB:A0A0B5JK45	0.629	0.637	2.217E-19	166	0.702	0.711	A0A0B5JK45.pdb.gz
3	PDB:5hk5F	0.557	0.712	2.581E-16	129	0.732	0.953	5hk5F.pdb.gz
4	AFDB:R0KDQ4	0.579	0.531	5.280E-15	184	0.571	0.522	R0KDQ4.pdb.gz	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
5	AFDB:O35793	0.574	0.526	8.739E-15	184	0.560	0.511	O35793.pdb.gz	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
6	AFDB:O73754	0.578	0.536	1.618E-14	182	0.542	0.500	O73754.pdb.gz	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
7	AFDB:O73753	0.518	0.498	5.318E-8	175	0.214	0.206	O73753.pdb.gz	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
8	AFDB:O95813	0.476	0.310	6.290E-8	267	0.214	0.135	O95813.pdb.gz	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
9	AFDB:Q6NZ13	0.535	0.493	8.802E-8	183	0.256	0.235	Q6NZ13.pdb.gz	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
10	AFDB:A8E7M9	0.519	0.368	9.845E-8	243	0.250	0.173	A8E7M9.pdb.gz
11	AFDB:Q90YC9	0.519	0.494	1.457E-7	177	0.202	0.192	Q90YC9.pdb.gz	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
12	PDB:2k8pA	0.376	0.340	2.122E-4	189	0.179	0.159	2k8pA.pdb.gz
13	PDB:4my2A	0.413	0.160	2.969E-4	474	0.125	0.044	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
14	PDB:4mqwB	0.389	0.567	7.637E-3	109	0.113	0.174	4mqwB.pdb.gz
15	PDB:1hcnB	0.370	0.521	1.871E-2	110	0.125	0.191	1hcnB.pdb.gz
16	PDB:7t9iB	0.380	0.554	1.187E-1	109	0.101	0.156	7t9iB.pdb.gz
17	PDB:5nxsA	0.301	0.187	2.599E-1	290	0.113	0.066	5nxsA.pdb.gz
18	PDB:7uwmA	0.233	0.321	2.907E-1	109	0.125	0.193	7uwmA.pdb.gz
19	PDB:6q2sA	0.294	0.450	3.075E-1	98	0.107	0.184	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
20	PDB:5ntuA	0.287	0.169	5.383E-1	308	0.083	0.045	5ntuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H772	1.05e-123	347	168	1.000	1.000	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
2	O88273	6.49e-109	309	168	0.952	0.952	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
3	Q566Z5	1.39e-80	237	166	0.661	0.669	Q566Z5_DANRE Gremlin OS=Danio rerio OX=7955 GN=grem2 PE=2 SV=1
4	R0KDQ4	7.05e-64	196	184	0.595	0.543	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
5	O73754	5.49e-61	188	182	0.542	0.500	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
6	O60565	5.73e-61	188	184	0.554	0.505	GREM1_HUMAN Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1
7	O35793	6.46e-61	188	184	0.554	0.505	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
8	O70326	5.32e-60	186	184	0.548	0.500	GREM1_MOUSE Gremlin-1 OS=Mus musculus OX=10090 GN=Grem1 PE=2 SV=1
9	Q90YC9	7.21e-15	70.5	177	0.202	0.192	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
10	Q61477	2.28e-14	69.3	178	0.196	0.185	NBL1_MOUSE Neuroblastoma suppressor of tumorigenicity 1 OS=Mus musculus OX=10090 GN=Nbl1 PE=1 SV=2
11	O73753	3.18e-14	68.6	175	0.208	0.200	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
12	P41271	4.26e-14	68.6	181	0.196	0.182	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
13	Q6NZ13	1.01e-13	67.4	183	0.196	0.180	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
14	Q76C29	1.11e-11	63.2	243	0.244	0.169	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1
15	O95813	3.21e-11	62.0	267	0.185	0.116	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
16	Q9PWB0	6.11e-11	61.2	272	0.179	0.110	CER1_CHICK Cerberus OS=Gallus gallus OX=9031 GN=CER1 PE=2 SV=1
17	Q9PUK2	9.64e-11	60.8	272	0.179	0.110	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
18	O55233	3.29e-09	56.2	272	0.155	0.096	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
19	Q800X4	6.36e-07	49.7	217	0.167	0.129	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
20	P70041	9.00e-07	49.3	270	0.137	0.085	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19284 Arc_MA	4e+02	12.5	Arc MA domain
2	PF00007 Cys_knot	0.046	25.4	Cystine-knot domain
3	PF03045 DAN	1.5e-38	142.7	DAN domain
4	PF13676 TIR_2	11	18.0	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010382990.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010384838.1	0.945	Growth/differentiation factor 5
2	61622.XP_010370358.1	0.919	Bone morphogenetic protein 4
3	61622.XP_010386077.1	0.882	Bone morphogenetic protein 2
4	61622.XP_010363411.1	0.867	Bone morphogenetic protein 7
5	61622.XP_010366895.1	0.809	Gremlin 1, DAN family BMP antagonist
6	61622.XP_010380015.1	0.801	Bone morphogenetic protein 6
7	61622.XP_010386249.1	0.797	Bone morphogenetic protein 5
8	61622.XP_010352498.1	0.705	Bone morphogenetic protein 8B
9	61622.XP_010358276.1	0.685	Growth differentiation factor 9
10	61622.XP_010379704.1	0.633	BMP and activin membrane-bound inhibitor homolog
11	61622.XP_010364462.1	0.620	Dorsalizing factor. Key developmental protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta family bone morphogenetic proteins (BMPs) and sequestering them in latent complexes
12	61622.XP_010374571.1	0.543	Follistatin isoform X1
13	61622.XP_010378952.1	0.541	Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite
14	61622.XP_010383884.1	0.535	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
15	61622.XP_010359919.1	0.518	DAN domain BMP antagonist family member 5
16	61622.XP_010361528.1	0.511	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036122	0.999	BMP binding
GO:0097367	0.990	carbohydrate derivative binding
GO:1901681	0.989	sulfur compound binding
GO:0005539	0.967	glycosaminoglycan binding
GO:0005102	0.951	signaling receptor binding
GO:0042802	0.950	identical protein binding
GO:0030545	0.842	signaling receptor regulator activity
GO:0008201	0.829	heparin binding
GO:0048018	0.824	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0050794	0.994	regulation of cellular process
GO:0007275	0.993	multicellular organism development
GO:0050896	0.992	response to stimulus
GO:0009987	0.989	cellular process
GO:0048583	0.983	regulation of response to stimulus
GO:0090092	0.961	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048523	0.943	negative regulation of cellular process
GO:0090101	0.931	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051716	0.929	cellular response to stimulus
GO:0090287	0.927	regulation of cellular response to growth factor stimulus
GO:0023052	0.926	signaling
GO:0007154	0.926	cell communication
GO:0090288	0.911	negative regulation of cellular response to growth factor stimulus
GO:0003002	0.910	regionalization
GO:0009799	0.900	specification of symmetry
GO:0007165	0.889	signal transduction
GO:0030514	0.888	negative regulation of BMP signaling pathway
GO:0007166	0.833	cell surface receptor signaling pathway
GO:0009653	0.821	anatomical structure morphogenesis
GO:0009855	0.821	determination of bilateral symmetry
GO:0048731	0.748	system development
GO:0048518	0.722	positive regulation of biological process
GO:0048513	0.701	animal organ development
GO:0009953	0.683	dorsal/ventral pattern formation
GO:0019222	0.636	regulation of metabolic process
GO:0060255	0.622	regulation of macromolecule metabolic process
GO:0048522	0.621	positive regulation of cellular process
GO:0048263	0.594	determination of dorsal identity
GO:0048598	0.584	embryonic morphogenesis
GO:0009888	0.549	tissue development
GO:0065009	0.513	regulation of molecular function
GO:0031323	0.445	regulation of cellular metabolic process
GO:0080090	0.444	regulation of primary metabolic process
GO:0051171	0.444	regulation of nitrogen compound metabolic process
GO:0050793	0.429	regulation of developmental process
GO:0007178	0.426	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.408	cellular response to growth factor stimulus
GO:0030154	0.378	cell differentiation
GO:0010604	0.334	positive regulation of macromolecule metabolic process
GO:0019219	0.320	regulation of nucleobase-containing compound metabolic process
GO:0051239	0.312	regulation of multicellular organismal process
GO:0009889	0.311	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.929	extracellular space
GO:0005622	0.580	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]