StarFunc result for job id Q9H773

User Input

>input (170 residues)
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H773	1.000	1.000	1.223E-25	170	1.000	1.000	Q9H773.pdb.gz	DCTP1_HUMAN dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1
2	AFDB:Q9QY93	0.788	0.788	1.089E-19	170	0.759	0.759	Q9QY93.pdb.gz	DCTP1_MOUSE dCTP pyrophosphatase 1 OS=Mus musculus OX=10090 GN=Dctpp1 PE=1 SV=1
3	PDB:6sqwA	0.645	0.960	2.196E-14	114	0.576	0.860	6sqwA.pdb.gz	The First Structure of an Active Mammalian dCTPase and its Complexes With Substrate Analogs and Products.
4	PDB:2yf3C	0.477	0.520	3.162E-2	153	0.159	0.176	2yf3C.pdb.gz	Structural and Functional Insights Into Dr2231 Protein, the Mazg-Like Nucleoside Triphosphate Pyrophosphohydrolase from Deinococcus Radiodurans.
5	PDB:1y6xA	0.365	0.653	3.525E-2	87	0.106	0.207	1y6xA.pdb.gz
6	PDB:3craA	0.441	0.326	3.525E-2	239	0.124	0.088	3craA.pdb.gz
7	AFDB:Q9RS96	0.474	0.532	9.026E-2	148	0.165	0.189	Q9RS96.pdb.gz	Q9RS96_DEIRA HAD superfamily Cof-like phosphohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_2231 PE=1 SV=1
8	AFDB:Q6PEY1	0.215	0.226	1.321E-1	159	0.182	0.195	Q6PEY1.pdb.gz	TMM88_HUMAN Transmembrane protein 88 OS=Homo sapiens OX=9606 GN=TMEM88 PE=1 SV=1
9	AFDB:O05579	0.261	0.134	1.555E-1	358	0.147	0.070	O05579.pdb.gz	O05579_MYCTU Probable conserved transmembrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0996 PE=4 SV=1
10	AFDB:Q9VGI8	0.271	0.041	2.677E-1	1487	0.188	0.022	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
11	AFDB:Q9MBA1	0.258	0.088	4.611E-1	536	0.159	0.050	Q9MBA1.pdb.gz	CAO_ARATH Chlorophyllide a oxygenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAO PE=1 SV=1
12	AFDB:B9EJ80	0.305	0.064	6.051E-1	1147	0.118	0.017	B9EJ80.pdb.gz	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
13	AFDB:P20134	0.160	0.054	6.746E-1	766	0.135	0.030	P20134.pdb.gz	SFL1_YEAST Flocculation suppression protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFL1 PE=1 SV=3
14	AFDB:Q04210	0.172	0.181	6.746E-1	160	0.082	0.087	Q04210.pdb.gz	YET2_YEAST Endoplasmic reticulum transmembrane protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YET2 PE=1 SV=1
15	PDB:6tuyA	0.213	0.072	8.710E-1	667	0.088	0.022	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
16	PDB:2b5uA	0.201	0.101	1.143	470	0.088	0.032	2b5uA.pdb.gz
17	PDB:4dk2A	0.325	0.227	1.143	260	0.100	0.065	4dk2A.pdb.gz
18	PDB:7nsuD	0.199	0.106	1.143	420	0.071	0.029	7nsuD.pdb.gz
19	PDB:2v6l0	0.160	0.310	1.207	82	0.112	0.232	2v6l0.pdb.gz
20	PDB:5ew5A	0.196	0.092	1.207	490	0.082	0.029	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H773	1.17e-123	347	170	1.000	1.000	DCTP1_HUMAN dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1
2	Q9QY93	2.08e-88	257	170	0.759	0.759	DCTP1_MOUSE dCTP pyrophosphatase 1 OS=Mus musculus OX=10090 GN=Dctpp1 PE=1 SV=1
3	Q8JZM0	1.0	32.0	345	0.124	0.061	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
4	Q9LKF9	5.2	30.0	739	0.129	0.030	CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CPSF100 PE=1 SV=2
5	P42701	5.3	30.0	662	0.212	0.054	I12R1_HUMAN Interleukin-12 receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=IL12RB1 PE=1 SV=1
6	Q0E8P6	5.9	29.6	4236	0.124	0.005	Q0E8P6_DROME Beethoven OS=Drosophila melanogaster OX=7227 GN=btv PE=3 SV=3
7	Q9FL59	6.0	29.6	794	0.106	0.023	FTIP1_ARATH FT-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=FTIP1 PE=1 SV=1
8	P54860	9.7	29.3	961	0.212	0.037	UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08761 dUTPase_2	1.8e+02	13.8	dUTPase
2	PF03819 MazG	0.0028	29.1	MazG nucleotide pyrophosphohydrolase domain
3	PF12643 MazG-like	5.3e-06	37.9	MazG-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349576	0.968	Deoxycytidylate deaminase
2	9606.ENSP00000300738	0.940	Ribonucleoside-diphosphate reductase large subunit
3	9606.ENSP00000286648	0.933	Deoxycytidine kinase
4	9606.ENSP00000256722	0.930	UMP-CMP kinase 2, mitochondrial
5	9606.ENSP00000337060	0.930	Nucleoside diphosphate kinase A
6	9606.ENSP00000353770	0.921	Ribonucleoside-diphosphate reductase subunit M2
7	9606.ENSP00000257770	0.914	5'-nucleotidase
8	9606.ENSP00000376889	0.914	Nucleoside diphosphate kinase
9	9606.ENSP00000251810	0.909	Ribonucleoside-diphosphate reductase subunit M2 B
10	9606.ENSP00000410186	0.908	Adenylate kinase 9
11	9606.ENSP00000219479	0.905	Nucleoside diphosphate kinase, mitochondrial
12	9606.ENSP00000376886	0.905	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
13	9606.ENSP00000245552	0.904	5'(3')-deoxyribonucleotidase, cytosolic type
14	9606.ENSP00000219302	0.902	Nucleoside diphosphate kinase 3
15	9606.ENSP00000356785	0.902	Nucleoside diphosphate kinase 7
16	9606.ENSP00000373674	0.902	5'(3')-deoxyribonucleotidase, mitochondrial
17	9606.ENSP00000416658	0.902	Nucleoside diphosphate kinase 6
18	9606.ENSP00000235628	0.900	Cytosolic 5'-nucleotidase 1A
19	9606.ENSP00000339479	0.900	Cytosolic purine 5'-nucleotidase
20	9606.ENSP00000352904	0.900	Cytosolic 5'-nucleotidase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0047429	1.000	nucleoside triphosphate diphosphatase activity
GO:0097159	0.898	organic cyclic compound binding
GO:1901363	0.897	heterocyclic compound binding
GO:0043167	0.863	ion binding
GO:0043169	0.654	cation binding
GO:0047840	0.615	dCTP diphosphatase activity
GO:0000166	0.570	nucleotide binding
GO:0046872	0.510	metal ion binding
GO:0019103	0.508	pyrimidine nucleotide binding
GO:0000287	0.470	magnesium ion binding
GO:0032556	0.442	pyrimidine deoxyribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006139	0.988	nucleobase-containing compound metabolic process
GO:0044281	0.983	small molecule metabolic process
GO:1901135	0.983	carbohydrate derivative metabolic process
GO:0019692	0.969	deoxyribose phosphate metabolic process
GO:0009262	0.966	deoxyribonucleotide metabolic process
GO:0009394	0.963	2'-deoxyribonucleotide metabolic process
GO:0044260	0.949	cellular macromolecule metabolic process
GO:0072527	0.943	pyrimidine-containing compound metabolic process
GO:0009166	0.933	nucleotide catabolic process
GO:0050896	0.927	response to stimulus
GO:0006220	0.892	pyrimidine nucleotide metabolic process
GO:0006259	0.855	DNA metabolic process
GO:0009219	0.832	pyrimidine deoxyribonucleotide metabolic process
GO:0009141	0.786	nucleoside triphosphate metabolic process
GO:0051716	0.760	cellular response to stimulus
GO:1901565	0.691	organonitrogen compound catabolic process
GO:0072529	0.587	pyrimidine-containing compound catabolic process
GO:0071496	0.575	cellular response to external stimulus
GO:1901136	0.538	carbohydrate derivative catabolic process
GO:0006950	0.513	response to stress
GO:0033554	0.459	cellular response to stress
GO:0007154	0.413	cell communication
GO:0031668	0.329	cellular response to extracellular stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0005654	0.994	nucleoplasm
GO:0005739	0.928	mitochondrion
GO:0071944	0.370	cell periphery
GO:0016020	0.355	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.9	1.000	nucleotide diphosphatase.
RHEA:22636	0.615	dCTP + H2O = dCMP + diphosphate + H(+)
EC:3.6.1.12	0.615	dCTP diphosphatase.

[back to server]