StarFunc result for job id Q9H792

User Input

>input (1746 residues)
MSACNTFTEHVWKPGECKNCFKPKSLHQLPPDPEKAPITHGNVKTNANHSNNHRIRNTGN
FRPPVAKKPTIAVKPTMIVADGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNN
EDDEGISHVPKPYGNNDSAKKMSDNNNGLTEVLKEIAGLDTAPQIRGNETNSRETFLGRI
NDCYKRSLERKLPPSCMIGGIKETQGKHVILSGSTEVISNEGGRFCYPEFSSGEESEEDV
LFSNMEEEHESWDESDEELLAMEIRMRGQPRFANFRANTLSPVRFFVDKKWNTIPLRNKS
LQRICAVDYDDSYDEILNGYEENSVVSYGQGSIQSMVSSDSTSPDSSLTEESRSETASSL
SQKICNGGLSPGNPGDSKDMKEIEPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALR
LEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCKPYTVVDV
SAAMASEHLEGPVNSPKTKSSSSTPNSPVTSSSLTPGQISAHFQKSSAIRYQEVWTSSTS
PRQKIPKVELITSGTGPNVPPRKNCHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNN
AGMPPFPIIIHDEPTYARSSKNAIKVPIVINPNAYDNLAIYKSFLGTSGELSVKEKTTSV
ISHTYEEIETESKVPDNTTSKTTDCLQTKGFSNSTEHKRGSVAQKVQEFNNCLNRGQSSP
QRSYSSSHSSPAKIQRATQEPVAKIEGTQESQMVGSSSTREKASTVLSQIVASIQPPQSP
PETPQSGPKACSVEELYAIPPDADVAKSTPKSTPVRPKSLFTSQPSGEAEAPQTTDSPTT
KVQKDPSIKPVTPSPSKLVTSPQSEPPAPFPPPRSTSSPYHAGNLLQRHFTNWTKPTSPT
RSTEAESVLHSEGSRRAADAKPKRWISFKSFFRRRKTDEEDDKEKEREKGKLVGLDGTVI
HMLPPPPVQRHHWFTEAKGESSEKPAIVFMYRCDPAQGQLSVDQSKARTDQAAVMEKGRA
ENALLQDSEKKRSHSSPSQIPKKILSHMTHEVTEDFSPRDPRTVVGKQDGRGCTSVTTAL
SLPELEREDGKEDISDPMDPNPCSATYSNLGQSRAAMIPPKQPRQPKGAVDDAIAFGGKT
DQEAPNASQPTPPPLPKKMIIRANTEPISKDLQKSMESSLCVMANPTYDIDPNWDASSAG
SSISYELKGLDIESYDSLERPLRKERPVPSAANSISSLTTLSIKDRFSNSMESLSSRRGP
SCRQGRGIQKPQRQALYRGLENREEVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFG
VDSWSDFRLTSDKPCCEAGDAVYYTASYAKDPLNNYAVKICKSKAKESQQYYHSLAVRQS
LAVHFNIQQDCGHFLAEVPNRLLPWEDPDDPEKDEDDMEETEEDAKGETDGKNPKPCSEA
ASSQKENQGVMSKKQRSHVVVITREVPCLTVADFVRDSLAQHGKSPDLYERQVCLLLLQL
CSGLEHLKPYHVTHCDLRLENLLLVHYQPGGTAQGFGPAEPSPTSSYPTRLIVSNFSQAK
QKSHLVDPEILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENPELKEREY
TRADLPRIPFRSPYSRGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQTFTA
CPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQYLAFATTDSLSCIV
KILQHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69Z38	0.368	0.369	0.000	1735	0.859	0.864	Q69Z38.pdb.gz	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4
2	AFDB:Q9H792	1.000	1.000	0.000	1746	1.000	1.000	Q9H792.pdb.gz	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4
3	AFDB:X1WGC5	0.295	0.298	0.000	1725	0.516	0.522	X1WGC5.pdb.gz	X1WGC5_DANRE Pseudopodium-enriched atypical kinase 1 OS=Danio rerio OX=7955 GN=peak1 PE=4 SV=1
4	AFDB:Q86YV5	0.226	0.278	1.214E-45	1406	0.244	0.303	Q86YV5.pdb.gz	PRAG1_HUMAN Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4
5	AFDB:Q571I4	0.223	0.283	1.349E-45	1373	0.251	0.320	Q571I4.pdb.gz	PRAG1_MOUSE Inactive tyrosine-protein kinase PRAG1 OS=Mus musculus OX=10090 GN=Prag1 PE=1 SV=3
6	AFDB:F4HQ88	0.135	0.194	1.805E-9	1169	0.104	0.155	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
7	PDB:8dksA	0.119	0.631	8.050E-9	283	0.033	0.201	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
8	PDB:6khdB	0.125	0.567	1.517E-8	332	0.034	0.181	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
9	PDB:5u6yA	0.118	0.409	2.196E-8	459	0.033	0.124	5u6yA.pdb.gz
10	PDB:4eomC	0.124	0.681	2.713E-8	276	0.030	0.188	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
11	PDB:6qx9K	0.122	0.595	2.860E-8	322	0.034	0.183	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:1j1bB	0.120	0.490	3.178E-8	364	0.036	0.173	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
13	PDB:4c0tA	0.127	0.651	3.532E-8	291	0.032	0.189	4c0tA.pdb.gz
14	PDB:4fl2A	0.125	0.358	4.363E-8	555	0.034	0.106	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:2yaaA	0.114	0.531	5.682E-8	300	0.031	0.180	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:2bujA	0.127	0.658	6.657E-8	291	0.030	0.182	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
17	AFDB:Q8INJ8	0.133	0.210	4.159E-7	1052	0.108	0.179	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
18	AFDB:A1Z6I7	0.133	0.156	1.642E-6	1460	0.112	0.134	A1Z6I7.pdb.gz	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
19	AFDB:Q9VP22	0.126	0.185	9.890E-6	1157	0.082	0.124	Q9VP22.pdb.gz	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1
20	AFDB:P18161	0.129	0.189	1.043E-5	1155	0.090	0.137	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69Z38	0.0	2971	1735	0.859	0.865	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4
2	Q9H792	0.0	3614	1746	1.000	1.000	PEAK1_HUMAN Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4
3	X1WGC5	0.0	1419	1725	0.529	0.535	X1WGC5_DANRE Pseudopodium-enriched atypical kinase 1 OS=Danio rerio OX=7955 GN=peak1 PE=4 SV=1
4	D3ZMK9	1.53e-119	413	1368	0.149	0.191	PRAG1_RAT Inactive tyrosine-protein kinase PRAG1 OS=Rattus norvegicus OX=10116 GN=Prag1 PE=1 SV=1
5	Q86YV5	4.86e-118	410	1406	0.129	0.161	PRAG1_HUMAN Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4
6	E0W1I1	1.97e-09	64.7	575	0.038	0.117	PINK1_PEDHC Serine/threonine-protein kinase Pink1, mitochondrial OS=Pediculus humanus subsp. corporis OX=121224 GN=Pink1 PE=1 SV=1
7	D6WMX4	2.97e-09	64.3	570	0.028	0.086	PINK1_TRICA Serine/threonine-protein kinase Pink1, mitochondrial OS=Tribolium castaneum OX=7070 GN=Pink1 PE=1 SV=1
8	Q0KHV6	9.57e-09	62.8	721	0.034	0.083	PINK1_DROME Serine/threonine-protein kinase Pink1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pink1 PE=1 SV=1
9	Q5PRB2	1.67e-08	61.6	574	0.034	0.103	Q5PRB2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wu:fc39e12 PE=2 SV=1
10	Q571I4	1.75e-08	62.4	1373	0.024	0.031	PRAG1_MOUSE Inactive tyrosine-protein kinase PRAG1 OS=Mus musculus OX=10090 GN=Prag1 PE=1 SV=3
11	Q6IS31	1.79e-06	55.1	558	0.032	0.100	Q6IS31_MOUSE non-specific serine/threonine protein kinase (Fragment) OS=Mus musculus OX=10090 GN=Pink1 PE=2 SV=1
12	B5DFG1	1.86e-06	55.1	580	0.035	0.105	PINK1_RAT Serine/threonine-protein kinase PINK1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pink1 PE=1 SV=1
13	J9W0G9	2.56e-06	54.7	575	0.030	0.092	YPK1_CRYNH Serine/threonine-protein kinase YPK1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=YPK1 PE=1 SV=1
14	Q99MQ3	3.05e-06	54.3	580	0.032	0.095	PINK1_MOUSE Serine/threonine-protein kinase PINK1, mitochondrial OS=Mus musculus OX=10090 GN=Pink1 PE=1 SV=2
15	Q4WPF2	3.48e-06	54.7	973	0.034	0.061	ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=atg1 PE=3 SV=1
16	P49071	1.96e-05	51.2	359	0.027	0.131	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
17	Q6ZS72	2.89e-05	51.2	473	0.019	0.070	PEAK3_HUMAN Protein PEAK3 OS=Homo sapiens OX=9606 GN=PEAK3 PE=1 SV=1
18	Q01919	2.94e-05	51.6	800	0.027	0.059	KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIN4 PE=1 SV=1
19	I1E3I7	3.37e-05	50.4	339	0.029	0.150	I1E3I7_GLYSO Membrane-associated/ABA-activated and calcium-independent protein kinase OS=Glycine soja OX=3848 GN=APK PE=2 SV=1
20	P93025	3.56e-05	51.2	915	0.028	0.054	PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana OX=3702 GN=PHOT2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	8.9e-09	46.7	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	0.011	26.7	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452796

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.912	Growth factor receptor-bound protein 2
2	9606.ENSP00000267970	0.865	Tetraspanin-3
3	9606.ENSP00000401303	0.851	SHC-transforming protein 1
4	9606.ENSP00000300574	0.735	Adapter molecule crk
5	9606.ENSP00000454973	0.706	S phase cyclin A-associated protein in the endoplasmic reticulum
6	9606.ENSP00000468308	0.696	Pseudokinase FAM20A
7	9606.ENSP00000336702	0.658	Eukaryotic translation initiation factor 5A-1
8	9606.ENSP00000352925	0.652	Transformation/transcription domain-associated protein
9	9606.ENSP00000398882	0.652	Deoxyhypusine hydroxylase
10	9606.ENSP00000482732	0.649	Tyrosine-protein phosphatase non-receptor type 9
11	9606.ENSP00000326031	0.642	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
12	9606.ENSP00000295822	0.628	Eukaryotic translation initiation factor 5A-2
13	9606.ENSP00000341779	0.625	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
14	9606.ENSP00000452746	0.620	Proline-serine-threonine phosphatase-interacting protein 1
15	9606.ENSP00000341189	0.613	Focal adhesion kinase 1
16	9606.ENSP00000367615	0.589	Adenine phosphoribosyltransferase
17	9606.ENSP00000284273	0.560	Ubiquitin-associated and SH3 domain-containing protein B
18	9606.ENSP00000391669	0.558	Breast cancer anti-estrogen resistance protein 1
19	9606.ENSP00000290759	0.549	Insulin gene enhancer protein ISL-2
20	9606.ENSP00000210060	0.518	Deoxyhypusine synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0042802	0.993	identical protein binding
GO:0004713	0.978	protein tyrosine kinase activity
GO:0004715	0.971	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0008152	0.986	metabolic process
GO:0051128	0.980	regulation of cellular component organization
GO:0016043	0.957	cellular component organization
GO:0071704	0.956	organic substance metabolic process
GO:0044238	0.946	primary metabolic process
GO:0006793	0.918	phosphorus metabolic process
GO:0043170	0.907	macromolecule metabolic process
GO:0036211	0.904	protein modification process
GO:0006796	0.894	phosphate-containing compound metabolic process
GO:0150116	0.891	regulation of cell-substrate junction organization
GO:0007160	0.803	cell-matrix adhesion
GO:0010810	0.787	regulation of cell-substrate adhesion
GO:0150115	0.749	cell-substrate junction organization
GO:0044087	0.650	regulation of cellular component biogenesis
GO:1901888	0.640	regulation of cell junction assembly
GO:0034446	0.611	substrate adhesion-dependent cell spreading
GO:0001952	0.549	regulation of cell-matrix adhesion
GO:0006468	0.520	protein phosphorylation
GO:0048518	0.501	positive regulation of biological process
GO:0048522	0.486	positive regulation of cellular process
GO:0046777	0.437	protein autophosphorylation
GO:0048583	0.328	regulation of response to stimulus
GO:0050896	0.311	response to stimulus
GO:0090109	0.301	regulation of cell-substrate junction assembly
GO:0007044	0.301	cell-substrate junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	1.000	focal adhesion
GO:0015629	1.000	actin cytoskeleton
GO:0043227	0.829	membrane-bounded organelle
GO:0043231	0.821	intracellular membrane-bounded organelle
GO:0005737	0.814	cytoplasm
GO:0005634	0.655	nucleus
GO:0005829	0.541	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.978	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.971	non-specific protein-tyrosine kinase.

[back to server]