StarFunc result for job id Q9H799

User Input

>input (1400 residues)
MEIRLEILTSTGIKQKKPWPRVSWLGKEKEAVFLLDDKFINEINLLSGKIKKKIPSLQPF
LKDVIVLTTSSNDAWLAGVLTTGELFLWNKDQDCLKTIPITEKPKEMIKATVASSLRLYL
YVSGNGKRIVLITPSGCIFLWEYLELKNILSSKSLSLAGRWSQVIPEEAVLLPSTEDKEA
VVNAVFIKNELFGDCCLCSFTFYSGECLKLTFLAIRWHENVFTSVRSLPYHVHWAQQDCH
LCSLIPKCESVKSRGALISAFSRDGLTLAVTLNQKDPKATQVLFINTLNFVTLCGSLKGC
SNKSPVVPATLIRSYWVGDISWTHDSLFLACMLKRGSLVLLTCQGELLTLITFGCSIEFG
PAEFIPLHPLITYRPQQFTFQDSNNSVDSSASDSDPMRQRFSIKAHSRLPYLVISDGYMV
TTLRFLDSLSPSVHMRSLLLDSTQRLEKIYQSVILSKPKGKGLNLRSLNSLRSSLLEHQG
NESSADFTVPKFLQAEETINENAADFQDFEAEETNEGRHFPDNLCPFWNKRDDVLCSSMK
EGRLEFASMFDTIHAKDDSEETDRTITELHSIQKSLLAAWTIGISKTVTEKNLMLNYIVV
CITHFFYILQFIKCPFPKLDLVLSKSSRHNAWILCIFQLFHQCLSIHYWDIRYKQDVGHL
IKLTSNTVKLLLTQQQKGQLFSEKLLACFYLLKMVADNLNGVYILQPEVISASADGSKIT
AQDSLVVPIFQMFQDSGFQKNWSWNSFFKIHPQVVNPVQQPGHRLLILWRILYKKTLWYQ
AQLNRRVPEADSQLTEKMTHEASTVKSLLCHLQANLQSTGDCLNQTLELKSINGEECFLL
GSYEKSVQLWKKALQEIEEKGGRRTYFLQIRYYLSLLYCHLYSYNLNDAQGLCDQLAREI
LRWSQLPVKENKDFSGAAKSHFECGMVGGVHPEAAVRVVQSMARFMAAYFTNQQLCILPP
HHVNVLPPLHIKTEQSFRLIPLQHSKVASVVRDQNLSNVWTVEYALELLFIGGLVPEAVW
LAYKLGDWKTSVSIGVAFQLFCKRDSNFMRSKKKSLNLPLRMTPAQIFQEKLQCVLGQPA
SLEAKNEMGSKYKQFTDPIEEEDANLLFGSVQEVLKASVMADADILSETFQLLIDSAKDF
SKRLWGLVPFGLYLPAPPLYCPQPAILSEEDGDDLLLKAEKNNRQKVSGILQRVLLLFRA
AQCSFPVAQWYILQLRWARKVMQKIRMKGSLPSLSPFPQSLLNYCKGGIAFFRPGAAGDH
KLDEVSIRAIGCFRELCALCWMLHVRDKLSYSCRQYQKARENVKGEKDLEVEFDSCMIEH
CLSAVEWAYRMLPFSRFFNMEELIQDIILSLIGELPPIRKVAEIFVKAFPYPEDVRVPLR
DKYHSLHQRLRHCVVKGPQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VHG1	0.173	0.271	5.291E-8	833	0.072	0.121	Q9VHG1.pdb.gz	Q9VHG1_DROME Vacuolar protein sorting-associated protein 16 homolog OS=Drosophila melanogaster OX=7227 GN=Vps16A PE=1 SV=1
2	PDB:1xi4A	0.164	0.144	1.077E-7	1630	0.114	0.098	1xi4A.pdb.gz
3	PDB:7qpgR	0.146	0.102	4.339E-7	2208	0.128	0.081	7qpgR.pdb.gz
4	AFDB:D3YYM4	0.113	0.135	4.641E-7	1114	0.079	0.100	D3YYM4.pdb.gz	WDR72_MOUSE WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1
5	PDB:6lqsB1	0.174	0.282	1.896E-6	806	0.046	0.081	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
6	PDB:7ajuUL	0.128	0.208	2.058E-6	779	0.056	0.100	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
7	PDB:7wooC	0.131	0.137	2.632E-6	1325	0.113	0.119	7wooC.pdb.gz
8	PDB:7mq8LO	0.100	0.146	3.101E-6	848	0.046	0.075	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	AFDB:Q9UPZ3	0.141	0.169	3.184E-6	1129	0.111	0.137	Q9UPZ3.pdb.gz	HPS5_HUMAN BLOC-2 complex member HPS5 OS=Homo sapiens OX=9606 GN=HPS5 PE=1 SV=2
10	PDB:7q3dA	0.192	0.426	3.366E-6	545	0.056	0.145	7q3dA.pdb.gz
11	PDB:7r5jD4	0.130	0.137	4.484E-6	1312	0.110	0.117	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7mqaLQ	0.135	0.209	5.503E-6	830	0.046	0.077	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7wooD	0.124	0.124	5.973E-6	1398	0.110	0.110	7wooD.pdb.gz
14	AFDB:P25365	0.165	0.209	6.133E-6	1065	0.049	0.065	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
15	AFDB:Q0VA83	0.135	0.157	7.225E-6	1174	0.119	0.142	Q0VA83.pdb.gz	Q0VA83_DANRE LOC560531 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC560531 PE=2 SV=1
16	AFDB:Q6JWU9	0.088	0.098	1.088E-5	1226	0.085	0.097	Q6JWU9.pdb.gz
17	AFDB:Q9UTN4	0.171	0.418	1.574E-5	509	0.041	0.114	Q9UTN4.pdb.gz	PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfs2 PE=4 SV=1
18	AFDB:O43379	0.101	0.095	2.096E-5	1518	0.050	0.046	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
19	AFDB:Q59Y20	0.151	0.261	5.379E-5	724	0.048	0.093	Q59Y20.pdb.gz	DSE1_CANAL Protein DSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DSE1 PE=3 SV=1
20	AFDB:Q24371	0.155	0.259	8.796E-5	769	0.050	0.091	Q24371.pdb.gz	L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster OX=7227 GN=l(2)dtl PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L8I2G6	0.0	1483	3171	0.536	0.237	A0A1L8I2G6_XENLA Ciliogenesis and planar polarity effector 1 isoform X1 OS=Xenopus laevis OX=8355 GN=cplane1.L PE=4 SV=1
2	Q8CE72	0.0	2284	3214	0.786	0.343	CPLN1_MOUSE Ciliogenesis and planar polarity effector 1 OS=Mus musculus OX=10090 GN=Cplane1 PE=1 SV=4
3	Q9H799	0.0	2916	3197	1.000	0.438	CPLN1_HUMAN Ciliogenesis and planar polarity effector 1 OS=Homo sapiens OX=9606 GN=CPLANE1 PE=1 SV=4
4	F4I460	2.7	35.0	1500	0.015	0.014	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
5	Q14197	5.2	33.1	206	0.009	0.058	ICT1_HUMAN Large ribosomal subunit protein mL62 OS=Homo sapiens OX=9606 GN=MRPL58 PE=1 SV=1
6	Q57YK0	9.5	33.1	638	0.021	0.045	Q57YK0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.880 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18012 PH_17	3.1e+02	12.6	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389014

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231498	0.909	Nuclear pore complex protein Nup155
2	9606.ENSP00000265107	0.909	WD repeat-containing protein 70
3	9606.ENSP00000440638	0.796	Transmembrane protein 216
4	9606.ENSP00000258173	0.783	Transmembrane protein 231
5	9606.ENSP00000330460	0.776	Probable ATP-dependent RNA helicase DDX59
6	9606.ENSP00000282516	0.772	Nipped-B-like protein
7	9606.ENSP00000278826	0.748	Transmembrane protein 138
8	9606.ENSP00000483364	0.743	Tectonic-3
9	9606.ENSP00000386264	0.735	Transmembrane protein 237
10	9606.ENSP00000403465	0.722	Coiled-coil and C2 domain-containing protein 2A
11	9606.ENSP00000344314	0.720	Oral-facial-digital syndrome 1 protein
12	9606.ENSP00000381270	0.716	Protein broad-minded
13	9606.ENSP00000262210	0.711	Centrosome and spindle pole-associated protein 1
14	9606.ENSP00000389998	0.711	Meckelin
15	9606.ENSP00000334379	0.689	C2 domain-containing protein 3
16	9606.ENSP00000304941	0.686	Tectonic-2
17	9606.ENSP00000261499	0.685	B9 domain-containing protein 1
18	9606.ENSP00000380779	0.681	Tectonic-1
19	9606.ENSP00000369257	0.672	Protein fantom
20	9606.ENSP00000356774	0.662	Jouberin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044782	0.971	cilium organization
GO:0030031	0.969	cell projection assembly
GO:0060271	0.945	cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0005622	0.984	intracellular anatomical structure
GO:0043229	0.964	intracellular organelle
GO:0043232	0.927	intracellular non-membrane-bounded organelle
GO:0005856	0.871	cytoskeleton
GO:0035869	0.589	ciliary transition zone
GO:0043231	0.547	intracellular membrane-bounded organelle
GO:0015630	0.446	microtubule cytoskeleton
GO:0005737	0.434	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]