StarFunc result for job id Q9H7B4

User Input

>input (428 residues)
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLM
RCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSES
EKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVIC
NSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYL
DMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHW
KWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRI
FFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE
CDANIRAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CWR2	0.999	0.999	1.468E-70	428	0.939	0.939	Q9CWR2.pdb.gz	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
2	PDB:5ex0A	0.982	0.980	9.910E-66	429	0.995	0.993	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
3	AFDB:E7EZZ6	0.952	0.950	1.434E-44	429	0.463	0.462	E7EZZ6.pdb.gz
4	AFDB:Q32LV8	0.795	0.892	1.703E-37	380	0.416	0.468	Q32LV8.pdb.gz	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
5	AFDB:Q5RGL7	0.831	0.821	1.128E-33	434	0.301	0.297	Q5RGL7.pdb.gz	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
6	AFDB:Q7M6Z3	0.831	0.822	1.610E-32	433	0.301	0.298	Q7M6Z3.pdb.gz	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
7	PDB:5v3hA	0.816	0.799	1.865E-32	438	0.311	0.304	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
8	AFDB:Q5BJI7	0.835	0.823	3.662E-32	435	0.290	0.285	Q5BJI7.pdb.gz	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
9	AFDB:Q2MJQ9	0.816	0.728	2.024E-30	486	0.299	0.263	Q2MJQ9.pdb.gz	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
10	AFDB:Q6P0R5	0.847	0.754	2.229E-30	485	0.292	0.258	Q6P0R5.pdb.gz
11	AFDB:P97443	0.815	0.720	1.618E-29	490	0.318	0.278	P97443.pdb.gz	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
12	PDB:3n71A	0.797	0.736	1.874E-29	468	0.320	0.293	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
13	AFDB:Q7XJS0	0.807	0.725	2.993E-27	480	0.264	0.235	Q7XJS0.pdb.gz	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	PDB:6ox1B	0.286	0.259	3.047E-7	484	0.150	0.132	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
15	PDB:3qxyA	0.379	0.384	1.071E-6	420	0.143	0.145	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
16	PDB:5h6zA	0.202	0.615	9.472E-3	123	0.051	0.179	5h6zA.pdb.gz
17	PDB:7obeA	0.239	0.216	1.864E-2	480	0.051	0.046	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
18	PDB:5njxA	0.259	0.268	1.956E-2	413	0.037	0.039	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
19	PDB:2c2lA	0.237	0.344	2.261E-2	281	0.061	0.093	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
20	PDB:5wg6A	0.102	0.089	2.373E-2	517	0.084	0.070	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CWR2	0.0	823	428	0.939	0.939	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
2	Q9H7B4	0.0	887	428	1.000	1.000	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4
3	Q32LV8	1.92e-119	354	380	0.414	0.466	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
4	Q5RGL7	1.25e-71	233	434	0.299	0.295	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
5	Q9NRG4	6.91e-71	231	433	0.318	0.314	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
6	Q7M6Z3	1.04e-69	228	433	0.315	0.312	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
7	Q8R5A0	3.31e-69	227	433	0.315	0.312	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
8	Q8NB12	2.81e-68	226	490	0.322	0.282	SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 OS=Homo sapiens OX=9606 GN=SMYD1 PE=1 SV=1
9	Q5BJI7	3.40e-68	224	435	0.297	0.292	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
10	P97443	1.78e-67	224	490	0.322	0.282	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
11	Q2MJQ8	4.11e-65	218	473	0.315	0.285	Q2MJQ8_DANRE Histone methyltransferase SmyD1b OS=Danio rerio OX=7955 GN=symd1 PE=1 SV=1
12	Q2MJQ9	8.63e-62	209	486	0.315	0.278	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
13	Q7XJS0	3.44e-43	159	480	0.283	0.252	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	Q8I4F7	3.85e-30	124	507	0.280	0.237	SMYDL_CAEEL Histone-lysine N-methyltransferase set-18 OS=Caenorhabditis elegans OX=6239 GN=set-18 PE=1 SV=1
15	O94256	2.22e-27	115	483	0.243	0.215	SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set6 PE=3 SV=1
16	Q23084	1.49e-20	96.3	560	0.185	0.141	Q23084_CAEEL MYND-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-30 PE=1 SV=3
17	Q8IDE8	1.59e-19	92.8	509	0.185	0.155	Q8IDE8_PLAF7 Histone-lysine N-methyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1355300 PE=4 SV=1
18	A1Z8L3	1.35e-12	72.0	660	0.164	0.106	A1Z8L3_DROME SET and MYND domain-containing protein 4 OS=Drosophila melanogaster OX=7227 GN=Smyd4-3 PE=4 SV=1
19	Q95RZ8	1.65e-12	71.6	567	0.164	0.123	Q95RZ8_DROME SET and MYND domain-containing protein 4 OS=Drosophila melanogaster OX=7227 GN=Smyd4-3 PE=2 SV=1
20	Q8BTK5	5.58e-12	70.1	799	0.079	0.043	SMYD4_MOUSE SET and MYND domain-containing protein 4 OS=Mus musculus OX=10090 GN=Smyd4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	2.9e-13	62.0	SET domain
2	PF01753 zf-MYND	7.5e-07	40.4	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000044

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000014245	0.907	Mitogen-activated protein kinase kinase kinase 2
2	9601.ENSPPYP00000009619	0.816	Helicase with zinc finger
3	9601.ENSPPYP00000008923	0.765	Cellular tumor antigen p53
4	9601.ENSPPYP00000019159	0.758	Estrogen receptor
5	9601.ENSPPYP00000010837	0.716	Bromodomain containing 4
6	9601.ENSPPYP00000009011	0.708	Nuclear receptor corepressor 1
7	9601.ENSPPYP00000005760	0.674	Uncharacterized protein
8	9601.ENSPPYP00000015302	0.661	SET domain containing 5
9	9601.ENSPPYP00000010482	0.656	Histone-lysine N-methyltransferase, H3 lysine-79 specific
10	9601.ENSPPYP00000000338	0.655	Pongo abelii retinoblastoma binding protein 5 (RBBP5), mRNA
11	9601.ENSPPYP00000008244	0.647	SET domain containing 1A
12	9601.ENSPPYP00000020758	0.645	ASH2 like histone lysine methyltransferase complex subunit
13	9601.ENSPPYP00000015574	0.631	SET domain containing 2
14	9601.ENSPPYP00000006994	0.626	Heat shock protein 90 alpha family class A member 1
15	9601.ENSPPYP00000016040	0.626	Uncharacterized protein
16	9601.ENSPPYP00000017056	0.626	Heat shock protein 90kDa alpha (cytosolic), class A member 1
17	9601.ENSPPYP00000022146	0.623	WD repeat domain 5
18	9601.ENSPPYP00000001074	0.621	Belongs to the histone H3 family.
19	9601.ENSPPYP00000022371	0.621	annotation not available
20	9601.ENSPPYP00000020053	0.614	Lysine (K)-specific methyltransferase 2E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:1901363	0.952	heterocyclic compound binding
GO:0097159	0.952	organic cyclic compound binding
GO:0003676	0.856	nucleic acid binding
GO:0019899	0.797	enzyme binding
GO:0003677	0.796	DNA binding
GO:0043565	0.496	sequence-specific DNA binding
GO:0003690	0.301	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.986	cellular component organization
GO:0065007	0.969	biological regulation
GO:0050789	0.952	regulation of biological process
GO:0006325	0.941	chromatin organization
GO:0050794	0.940	regulation of cellular process
GO:0048856	0.922	anatomical structure development
GO:0019222	0.868	regulation of metabolic process
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0010468	0.851	regulation of gene expression
GO:0048519	0.835	negative regulation of biological process
GO:0048518	0.833	positive regulation of biological process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0080090	0.817	regulation of primary metabolic process
GO:0048523	0.815	negative regulation of cellular process
GO:0006355	0.811	regulation of DNA-templated transcription
GO:0050896	0.810	response to stimulus
GO:0065009	0.794	regulation of molecular function
GO:0048522	0.779	positive regulation of cellular process
GO:0009893	0.774	positive regulation of metabolic process
GO:0009892	0.742	negative regulation of metabolic process
GO:0051173	0.741	positive regulation of nitrogen compound metabolic process
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0051716	0.686	cellular response to stimulus
GO:0031399	0.685	regulation of protein modification process
GO:0061061	0.639	muscle structure development
GO:0042221	0.635	response to chemical
GO:0044237	0.622	cellular metabolic process
GO:0010033	0.605	response to organic substance
GO:0071704	0.601	organic substance metabolic process
GO:0031325	0.540	positive regulation of cellular metabolic process
GO:0043170	0.533	macromolecule metabolic process
GO:0006807	0.524	nitrogen compound metabolic process
GO:0044238	0.520	primary metabolic process
GO:0051174	0.512	regulation of phosphorus metabolic process
GO:0044260	0.480	cellular macromolecule metabolic process
GO:0051172	0.480	negative regulation of nitrogen compound metabolic process
GO:0010605	0.477	negative regulation of macromolecule metabolic process
GO:0031324	0.470	negative regulation of cellular metabolic process
GO:0032501	0.466	multicellular organismal process
GO:0042325	0.457	regulation of phosphorylation
GO:0043933	0.454	protein-containing complex organization
GO:0065003	0.410	protein-containing complex assembly
GO:0009719	0.407	response to endogenous stimulus
GO:1901654	0.407	response to ketone
GO:0048545	0.404	response to steroid hormone
GO:0019538	0.372	protein metabolic process
GO:0036211	0.345	protein modification process
GO:0032259	0.329	methylation
GO:1901655	0.328	cellular response to ketone
GO:0071310	0.327	cellular response to organic substance
GO:0071548	0.327	response to dexamethasone
GO:0071407	0.310	cellular response to organic cyclic compound
GO:0048513	0.308	animal organ development
GO:0045935	0.305	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.304	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.988	cytoplasm
GO:0005829	0.972	cytosol
GO:0032991	0.427	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]