StarFunc result for job id Q9H7C9

User Input

>input (122 residues)
MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
GVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHS
TC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R0P4	0.997	0.997	4.014E-26	122	0.918	0.918	Q8R0P4.pdb.gz	AAMDC_MOUSE Mth938 domain-containing protein OS=Mus musculus OX=10090 GN=Aamdc PE=1 SV=1
2	PDB:2ab1A	0.993	0.993	7.221E-26	122	0.992	0.992	2ab1A.pdb.gz
3	AFDB:Q9BU61	0.798	0.544	9.004E-8	184	0.189	0.125	Q9BU61.pdb.gz	NDUF3_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Homo sapiens OX=9606 GN=NDUFAF3 PE=1 SV=1
4	AFDB:Q93931	0.763	0.372	4.945E-7	270	0.221	0.100	Q93931.pdb.gz	Q93931_CAEEL NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Caenorhabditis elegans OX=6239 GN=nuaf-3 PE=1 SV=2
5	AFDB:Q9JKL4	0.795	0.539	5.279E-7	185	0.189	0.124	Q9JKL4.pdb.gz	NDUF3_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Mus musculus OX=10090 GN=Ndufaf3 PE=1 SV=1
6	AFDB:Q8RUX8	0.765	0.566	1.506E-6	170	0.156	0.112	Q8RUX8.pdb.gz	Q8RUX8_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Arabidopsis thaliana OX=3702 GN=At2g44525 PE=1 SV=1
7	AFDB:Q682I4	0.752	0.556	3.529E-6	170	0.139	0.100	Q682I4.pdb.gz	Q682I4_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Arabidopsis thaliana OX=3702 GN=At3g60150 PE=1 SV=1
8	AFDB:Q383V4	0.753	0.164	5.228E-6	629	0.123	0.024	Q383V4.pdb.gz	Q383V4_TRYB2 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1500 PE=4 SV=1
9	PDB:4rkkA	0.340	0.144	3.861E-2	317	0.107	0.041	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.
10	PDB:5jciA	0.212	0.085	4.700E-2	432	0.164	0.046	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
11	AFDB:Q0DX67	0.385	0.248	5.370E-2	204	0.090	0.054	Q0DX67.pdb.gz	DSP2_ORYSJ Probable tyrosine-protein phosphatase DSP2 OS=Oryza sativa subsp. japonica OX=39947 GN=DSP2 PE=2 SV=2
12	AFDB:Q9ZQP1	0.355	0.152	5.370E-2	337	0.123	0.045	Q9ZQP1.pdb.gz	TPMT1_ARATH Phosphatidylglycerophosphate phosphatase PTPMT1 OS=Arabidopsis thaliana OX=3702 GN=PTPMT1 PE=1 SV=2
13	AFDB:F4J117	0.369	0.091	8.494E-2	591	0.107	0.022	F4J117.pdb.gz	LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSF1 PE=1 SV=1
14	PDB:2grvA	0.228	0.079	1.632E-1	516	0.115	0.027	2grvA.pdb.gz
15	PDB:4g56A	0.184	0.064	1.860E-1	617	0.107	0.021	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
16	PDB:2vhwE	0.181	0.085	1.986E-1	373	0.123	0.040	2vhwE.pdb.gz	Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
17	PDB:2wopA	0.248	0.077	1.986E-1	554	0.123	0.027	2wopA.pdb.gz	Crystal Structures of an Oligopeptide-Binding Protein from the Biosynthetic Pathway of the Beta-Lactamase Inhibitor Clavulanic Acid.
18	PDB:2wu9A	0.322	0.125	2.581E-1	403	0.123	0.037	2wu9A.pdb.gz
19	PDB:6bqcA	0.220	0.094	2.942E-1	348	0.115	0.040	6bqcA.pdb.gz	Structural and Functional Analysis of E. coli Cyclopropane Fatty Acid Synthase.
20	PDB:3bxoA	0.232	0.143	3.354E-1	236	0.082	0.042	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7C9	5.42e-87	250	122	1.000	1.000	AAMDC_HUMAN Mth938 domain-containing protein OS=Homo sapiens OX=9606 GN=AAMDC PE=1 SV=1
2	Q8R0P4	8.74e-80	232	122	0.918	0.918	AAMDC_MOUSE Mth938 domain-containing protein OS=Mus musculus OX=10090 GN=Aamdc PE=1 SV=1
3	B2MZC3	3.23e-04	40.8	220	0.164	0.091	B2MZC3_CAEEL NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Caenorhabditis elegans OX=6239 GN=nuaf-3 PE=1 SV=1
4	Q93931	3.36e-04	40.8	270	0.164	0.074	Q93931_CAEEL NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Caenorhabditis elegans OX=6239 GN=nuaf-3 PE=1 SV=2
5	O44502	2.4	30.0	743	0.139	0.023	COG8_CAEEL Conserved oligomeric Golgi complex subunit 8 OS=Caenorhabditis elegans OX=6239 GN=cogc-8 PE=3 SV=1
6	P10566	3.9	29.3	314	0.131	0.051	MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS3 PE=1 SV=4
7	E7F0G2	4.2	29.3	869	0.098	0.014	E7F0G2_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=ndst1a PE=3 SV=1
8	P9WGK1	6.6	28.5	573	0.213	0.045	DOST_MYCTU Oxygen sensor histidine kinase response regulator DosT OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dosT PE=1 SV=1
9	Q59467	6.7	28.5	741	0.115	0.019	COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori OX=210 GN=copA PE=3 SV=1
10	O23722	7.1	28.5	412	0.230	0.068	MVD1_ARATH Diphosphomevalonate decarboxylase MVD1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MVD1 PE=1 SV=1
11	O28769	7.9	28.1	338	0.197	0.071	O28769_ARCFU HAMP domain-containing protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=AF_1503 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04430 DUF498	1.6e-17	74.9	Protein of unknown function (DUF498/DUF598)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000011090

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000013113	0.636	Cytosolic arginine sensor for mTORC1 subunit 1
2	9555.ENSPANP00000000995	0.626	Potassium channel tetramerization domain containing 14
3	9555.ENSPANP00000005675	0.558	Aminoadipate-semialdehyde dehydrogenase
4	9555.ENSPANP00000003260	0.557	Aminoacylase 3
5	9555.ENSPANP00000018493	0.549	Golgi reassembly stacking protein 2, 55kDa
6	9555.ENSPANP00000019446	0.536	AhpC/TSA antioxidant enzyme domain containing 1
7	9555.ENSPANP00000011585	0.532	Arginyl aminopeptidase (aminopeptidase B)
8	9555.ENSPANP00000004855	0.531	asparaginyl-tRNA synthetase 2, mitochondrial (putative)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.463	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0009058	0.968	biosynthetic process
GO:1901360	0.953	organic cyclic compound metabolic process
GO:0034641	0.953	cellular nitrogen compound metabolic process
GO:0006725	0.952	cellular aromatic compound metabolic process
GO:0050794	0.951	regulation of cellular process
GO:0046483	0.945	heterocycle metabolic process
GO:0080090	0.929	regulation of primary metabolic process
GO:0031323	0.922	regulation of cellular metabolic process
GO:0051171	0.920	regulation of nitrogen compound metabolic process
GO:0006139	0.904	nucleobase-containing compound metabolic process
GO:0019219	0.893	regulation of nucleobase-containing compound metabolic process
GO:0044249	0.826	cellular biosynthetic process
GO:0043170	0.825	macromolecule metabolic process
GO:1901576	0.738	organic substance biosynthetic process
GO:0048523	0.693	negative regulation of cellular process
GO:0048518	0.623	positive regulation of biological process
GO:0044271	0.605	cellular nitrogen compound biosynthetic process
GO:1901362	0.504	organic cyclic compound biosynthetic process
GO:0060255	0.497	regulation of macromolecule metabolic process
GO:0048522	0.481	positive regulation of cellular process
GO:0019438	0.473	aromatic compound biosynthetic process
GO:0010467	0.415	gene expression
GO:0018130	0.413	heterocycle biosynthetic process
GO:0009059	0.408	macromolecule biosynthetic process
GO:0016070	0.407	RNA metabolic process
GO:0009893	0.384	positive regulation of metabolic process
GO:0051252	0.375	regulation of RNA metabolic process
GO:0010468	0.374	regulation of gene expression
GO:0051173	0.369	positive regulation of nitrogen compound metabolic process
GO:0031325	0.369	positive regulation of cellular metabolic process
GO:1903506	0.349	regulation of nucleic acid-templated transcription
GO:0006355	0.342	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043227	0.962	membrane-bounded organelle
GO:0043229	0.896	intracellular organelle
GO:0043231	0.879	intracellular membrane-bounded organelle
GO:0005634	0.741	nucleus
GO:0005829	0.733	cytosol
GO:0031981	0.407	nuclear lumen
GO:0012505	0.349	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]