StarFunc result for job id Q9H7D0

User Input

>input (1870 residues)
MARWIPTKRQKYGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYTLQNKSKKGIFP
ETYIHLKEATVEDLGQHETVIPGELPLVQELTSTLREWAVIWRKLYVNNKLTLFRQLQQM
TYSLIEWRSQILSGTLPKDELAELKKKVTAKIDHGNRMLGLDLVVRDDNGNILDPDETST
IALFKAHEVASKRIEEKIQEEKSILQNLDLRGQSIFSTIHTYGLYVNFKNFVCNIGEDAE
LFMALYDPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSMDLIRPRVSLVCQI
VRVGHMELKEGKKHTCGLRRPFGVAVMDITDIIHGKVDDEEKQHFIPFQQIAMETYIRQR
QLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKLLPGDLTQVQKNFSHL
VDRSTAIARKMGFPEIILPGDVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVHDEEGKLL
EKAIHPGAGYEGISEYKSVVYYQVKQPCWYETVKVSIAIEEVTRCHIRFTFRHRSSQETR
DKSERAFGVAFVKLMNPDGTTLQDGRHDLVVYKGDNKKMEDAKFYLTLPGTKMEMEEKEL
QASKNLVTFTPSKDSTKDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKKLMEV
DGGEIVKFLQDTLDALFNIMMEMSDSETYDFLVFDALVFIISLIGDIKFQHFNPVLETYI
YKHFSATLAYVKLSKVLNFYVANADDSSKTELLFAALKALKYLFRFIIQSRVLYLRFYGQ
SKDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLF
CKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHE
ASSQLLSNILEVLDRKDVGATAVHIQLIMERLLRRINRTVIGMNRQSPHIGSFVACMIAL
LQQMDDSHYSHYISTFKTRQDIIDFLMETFIMFKDLIGKNVYAKDWMVMNMTQNRVFLRA
INQFAEVLTRFFMDQASFELQLWNNYFHLAVAFLTHESLQLETFSQAKRNKIVKKYGDMR
KEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNFSG
NGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHCRKHKYLSSSGEVFALLVSSL
LENLLDYRTIIMQDESKENRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHRDCENYTEA
AYTLLLHAELLQWSDKPCVPHLLQKDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKL
SKELAETYESKVFDYEGLGNLLKKRASFYENIIKAMRPQPEYFAVGYYGQGFPSFLRNKI
FIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQYMQCFTVKPVMSLPPS
YKDKPVPEQILNYYRANEVQQFRYSRPFRKGEKDPDNEFATMWIERTTYTTAYTFPGILK
WFEVKQISTEEISPLENAIETMELTNERISNCVQQHAWDRSLSVHPLSMLLSGIVDPAVM
GGFSNYEKAFFTEKYLQEHPEDQEKVELLKRLIALQMPLLTEGIRIHGEKLTEQLKPLHE
RLSSCFRELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVV
STSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLS
KSQVIAEKAPEPDLMSPTRKAQRPKSLQLMDNRLSPFHGSSPPQSTPLSPPPLTPKATRT
LSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTELAPPLPVRREAKAPPPPPPKARKS
GIPTSEPGSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUA6	0.602	0.610	0.000	1840	0.563	0.572	A0A0R4IUA6.pdb.gz
2	AFDB:B8JID6	0.878	0.879	0.000	1867	0.709	0.710	B8JID6.pdb.gz
3	AFDB:P59764	0.785	0.744	0.000	1978	0.359	0.339	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
4	AFDB:Q14185	0.799	0.801	0.000	1865	0.644	0.646	Q14185.pdb.gz	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
5	AFDB:Q8IZD9	0.816	0.753	0.000	2030	0.363	0.334	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
6	AFDB:Q92608	0.792	0.808	0.000	1830	0.543	0.555	Q92608.pdb.gz	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2
7	AFDB:Q9H7D0	0.999	0.999	0.000	1870	1.000	1.000	Q9H7D0.pdb.gz	DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3
8	PDB:6tgbA	0.620	0.781	2.830E-72	1450	0.361	0.466	6tgbA.pdb.gz
9	AFDB:Q06409	0.570	0.554	1.339E-52	1932	0.160	0.155	Q06409.pdb.gz	DCK1_YEAST DOCK-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCK1 PE=1 SV=1
10	AFDB:Q54DW1	0.227	0.244	1.092E-23	1736	0.093	0.100	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
11	AFDB:Q6PR54	0.148	0.122	3.122E-8	2419	0.096	0.074	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
12	PDB:6pyuA	0.073	0.138	2.209E-6	930	0.058	0.116	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	PDB:4yknA	0.071	0.104	7.607E-6	1205	0.072	0.111	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
14	PDB:5itdA	0.070	0.123	1.671E-5	995	0.046	0.086	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:5dxhD	0.070	0.124	3.042E-5	981	0.052	0.100	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
16	PDB:6qnxA	0.098	0.159	4.105E-5	928	0.062	0.125	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
17	PDB:3gb8A	0.120	0.193	4.262E-5	958	0.056	0.110	3gb8A.pdb.gz
18	PDB:7nj1A	0.072	0.085	6.936E-5	1448	0.078	0.100	7nj1A.pdb.gz
19	PDB:1qgkA	0.114	0.205	9.016E-5	876	0.055	0.116	1qgkA.pdb.gz
20	PDB:7ajuUT	0.095	0.084	1.009E-4	2313	0.051	0.042	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096LNH6	2407	1886	0.642	0.637	A0A096LNH6_HUMAN Dedicator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=1
2	A0A0B4K7Q6	1224	2008	0.390	0.364	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
3	A0A0B4KHD2	1043	2008	0.343	0.320	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
4	A8E1V6	2402	1866	0.643	0.644	A8E1V6_DANRE Dedicator of cytokinesis 1 OS=Danio rerio OX=7955 GN=dock1 PE=1 SV=1
5	A8E1V7	2672	1867	0.709	0.710	A8E1V7_DANRE Dedicator of cytokinesis 5 OS=Danio rerio OX=7955 GN=dock5 PE=1 SV=1
6	B2RY04	3570	1868	0.939	0.940	DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2
7	B7Z0R2	1049	2002	0.342	0.320	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
8	H0Y599	1120	1999	0.338	0.316	H0Y599_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
9	H0Y7N4	2050	1090	0.529	0.908	H0Y7N4_HUMAN Dedicator of cytokinesis 5 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=1
10	P59764	1146	1978	0.342	0.323	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
11	Q14185	2389	1865	0.639	0.641	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
12	Q149N5	1135	2011	0.341	0.317	Q149N5_HUMAN DOCK4 protein OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
13	Q8BUR4	2403	1865	0.634	0.636	DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus OX=10090 GN=Dock1 PE=1 SV=3
14	Q8C3J5	1994	1828	0.540	0.552	DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3
15	Q8CIQ7	1140	2027	0.349	0.322	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
16	Q8IZD9	1145	2030	0.348	0.320	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
17	Q8MQW7	782	1292	0.248	0.359	Q8MQW7_DROME SD06708p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
18	Q8MQY7	1101	1543	0.326	0.395	Q8MQY7_DROME RE54856p OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
19	Q8N1I0	1157	1966	0.341	0.325	DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3
20	Q92608	1996	1830	0.544	0.556	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	9e-19	79.8	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	1.9e-12	58.5	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	6.1e-15	66.4	DHR-2, Lobe C
4	PF14429 DOCK-C2	4.4e-58	207.7	C2 domain in Dock180 and Zizimin proteins
5	PF16172 DOCK_N	2.2e-100	347.9	DOCK N-terminus
6	PF17655 IRK_C	3.5e+02	12.2	Inward rectifier potassium channel C-terminal domain
7	PF00018 SH3_1	6.3e-06	37.0	SH3 domain
8	PF07653 SH3_2	0.0008	30.5	Variant SH3 domain
9	PF14604 SH3_9	0.00041	31.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312185	0.928	Engulfment and cell motility protein 1
2	9606.ENSP00000300574	0.887	Adapter molecule crk
3	9606.ENSP00000346300	0.834	Crk-like protein
4	9606.ENSP00000290246	0.815	Engulfment and cell motility protein 2
5	9606.ENSP00000383118	0.808	Cell division control protein 42 homolog
6	9606.ENSP00000348461	0.765	Ras-related C3 botulinum toxin substrate 1
7	9606.ENSP00000282026	0.727	ADP-ribosylation factor-like protein 11
8	9606.ENSP00000310263	0.720	Tumor necrosis factor receptor superfamily member 10D
9	9606.ENSP00000377566	0.695	Engulfment and cell motility protein 3
10	9606.ENSP00000362680	0.680	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000400646	0.663	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
12	9606.ENSP00000325240	0.662	LIM and SH3 domain protein 1
13	9606.ENSP00000336752	0.656	Pre-mRNA 3'-end-processing factor FIP1
14	9606.ENSP00000332706	0.654	Transcriptional activator protein Pur-alpha
15	9606.ENSP00000325074	0.653	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
16	9606.ENSP00000372023	0.653	Serine/threonine-protein kinase Chk2
17	9606.ENSP00000366267	0.651	Glypican-5
18	9606.ENSP00000221200	0.642	BTB/POZ domain-containing protein KCTD9
19	9606.ENSP00000313243	0.629	Heat shock factor protein 5
20	9606.ENSP00000359935	0.628	Fucose-1-phosphate guanylyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048856	0.956	anatomical structure development
GO:0050896	0.940	response to stimulus
GO:0071840	0.929	cellular component organization or biogenesis
GO:0051716	0.917	cellular response to stimulus
GO:0032501	0.909	multicellular organismal process
GO:0016043	0.894	cellular component organization
GO:0030154	0.866	cell differentiation
GO:0006996	0.849	organelle organization
GO:0007154	0.848	cell communication
GO:0023052	0.844	signaling
GO:0030335	0.826	positive regulation of cell migration
GO:0045785	0.796	positive regulation of cell adhesion
GO:0007165	0.789	signal transduction
GO:0009653	0.774	anatomical structure morphogenesis
GO:0010810	0.704	regulation of cell-substrate adhesion
GO:0010632	0.682	regulation of epithelial cell migration
GO:0048583	0.679	regulation of response to stimulus
GO:0035556	0.678	intracellular signal transduction
GO:0009966	0.662	regulation of signal transduction
GO:0010811	0.645	positive regulation of cell-substrate adhesion
GO:0048646	0.643	anatomical structure formation involved in morphogenesis
GO:1900026	0.629	positive regulation of substrate adhesion-dependent cell spreading
GO:0048468	0.578	cell development
GO:0065008	0.554	regulation of biological quality
GO:0007520	0.520	myoblast fusion
GO:0048519	0.497	negative regulation of biological process
GO:1902531	0.493	regulation of intracellular signal transduction
GO:0090066	0.393	regulation of anatomical structure size
GO:0007264	0.379	small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.995	organelle
GO:0043229	0.994	intracellular organelle
GO:0031974	0.984	membrane-enclosed lumen
GO:0016020	0.964	membrane
GO:0043227	0.955	membrane-bounded organelle
GO:0071944	0.947	cell periphery
GO:0005886	0.943	plasma membrane
GO:0043231	0.932	intracellular membrane-bounded organelle
GO:0070013	0.900	intracellular organelle lumen
GO:0005634	0.900	nucleus
GO:0043228	0.807	non-membrane-bounded organelle
GO:0043232	0.798	intracellular non-membrane-bounded organelle
GO:0031981	0.634	nuclear lumen
GO:0005654	0.475	nucleoplasm
GO:0012505	0.360	endomembrane system
GO:0031982	0.333	vesicle
GO:0032991	0.321	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]