StarFunc result for job id Q9H7E2

User Input

>input (651 residues)
MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGE
VEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMP
VKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKST
KSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVM
GPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQ
YRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGSGLPRNRGSER
PSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSF
AEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTD
YQNPVRSNSFIGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKP
EKILESSIPMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEV
LLSNIKPIQTEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRARN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZE0	0.238	0.238	2.761E-95	651	1.000	1.000	A0A024QZE0.pdb.gz
2	AFDB:Q9P7E8	0.073	0.057	2.686E-4	857	0.132	0.100	Q9P7E8.pdb.gz	APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=app1 PE=2 SV=1
3	AFDB:P61407	0.086	0.031	9.168E-4	2134	0.094	0.029	P61407.pdb.gz	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
4	AFDB:Q6SJR1	0.053	0.048	2.448E-3	720	0.108	0.097	Q6SJR1.pdb.gz	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1
5	AFDB:P59808	0.079	0.045	3.328E-3	1230	0.143	0.076	P59808.pdb.gz	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
6	PDB:3mp8A	0.077	0.097	7.047E-3	513	0.023	0.029	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
7	AFDB:Q96JE9	0.052	0.043	8.356E-3	813	0.135	0.108	Q96JE9.pdb.gz	MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens OX=9606 GN=MAP6 PE=1 SV=2
8	AFDB:O95153	0.072	0.028	8.885E-3	1857	0.140	0.049	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
9	AFDB:P54253	0.059	0.050	1.005E-2	815	0.115	0.092	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
10	AFDB:Q8IZP0	0.070	0.085	1.642E-2	508	0.092	0.118	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
11	AFDB:O95835	0.083	0.054	1.856E-2	1130	0.143	0.082	O95835.pdb.gz	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
12	PDB:4pa0A	0.066	0.045	4.444E-2	974	0.011	0.007	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4zn3A	0.085	0.340	5.024E-2	147	0.012	0.054	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
14	PDB:6c6sD	0.072	0.256	5.681E-2	161	0.015	0.062	6c6sD.pdb.gz	Structural Basis for Transcript Elongation Control by NusG Family Universal Regulators.
15	PDB:1k9aB	0.069	0.101	6.423E-2	441	0.017	0.025	1k9aB.pdb.gz
16	PDB:6s01K	0.077	0.492	9.870E-2	86	0.017	0.128	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
17	PDB:6tedZ	0.069	0.087	9.870E-2	510	0.011	0.014	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:7abi7	0.073	0.194	9.870E-2	236	0.018	0.051	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
19	PDB:7nkxZ	0.067	0.258	1.187E-1	156	0.011	0.045	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:2h8hA	0.070	0.101	1.262E-1	445	0.014	0.020	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7E2	0.0	1351	651	1.000	1.000	TDRD3_HUMAN Tudor domain-containing protein 3 OS=Homo sapiens OX=9606 GN=TDRD3 PE=1 SV=1
2	Q8L502	1.68e-12	72.4	443	0.055	0.081	Q8L502_ARATH AT5G19950 protein OS=Arabidopsis thaliana OX=3702 GN=At5g19950 PE=1 SV=1
3	A0A0A0MSU3	1.21e-08	60.1	415	0.043	0.067	A0A0A0MSU3_HUMAN RecQ-mediated genome instability protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RMI1 PE=1 SV=1
4	Q9H9A7	3.24e-08	59.3	625	0.043	0.045	RMI1_HUMAN RecQ-mediated genome instability protein 1 OS=Homo sapiens OX=9606 GN=RMI1 PE=1 SV=3
5	Q9D4G9	2.27e-06	53.1	616	0.049	0.052	RMI1_MOUSE RecQ-mediated genome instability protein 1 OS=Mus musculus OX=10090 GN=Rmi1 PE=2 SV=1
6	Q58EK5	8.42e-06	51.6	1175	0.040	0.022	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
7	Q9W6S8	5.60e-05	47.8	281	0.032	0.075	SMN1_DANRE Survival motor neuron protein 1 OS=Danio rerio OX=7955 GN=smn1 PE=1 SV=1
8	P91399	7.42e-05	48.5	926	0.043	0.030	RMI1_CAEEL RecQ-mediated genome instability protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rmh-1 PE=1 SV=1
9	A9CPT4	7.75e-05	48.5	1133	0.035	0.020	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
10	Q581X8	1.08e-04	46.6	251	0.043	0.112	Q581X8_TRYB2 RecQ mediated genome instability protein 1-like N-terminal helical domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.520 PE=4 SV=1
11	O75940	1.20e-04	46.2	238	0.035	0.097	SPF30_HUMAN Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1
12	G5EF82	1.28e-04	47.4	615	0.035	0.037	G5EF82_CAEEL RecQ-mediated genome instability protein 1 OS=Caenorhabditis elegans OX=6239 GN=rmh-2 PE=3 SV=1
13	Q99MV1	6.09e-04	45.4	1172	0.032	0.018	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
14	G7H806	0.001	43.1	230	0.032	0.091	G7H806_DROME FI15931p1 OS=Drosophila melanogaster OX=7227 GN=Spf30 PE=1 SV=1
15	Q95RI7	0.001	43.1	243	0.032	0.086	Q95RI7_DROME LD28068p OS=Drosophila melanogaster OX=7227 GN=Spf30 PE=1 SV=1
16	Q9BXT4	0.001	44.7	1180	0.032	0.018	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
17	P97801	0.002	43.1	288	0.032	0.073	SMN_MOUSE Survival motor neuron protein OS=Mus musculus OX=10090 GN=Smn1 PE=1 SV=1
18	O35876	0.003	42.4	289	0.032	0.073	SMN_RAT Survival motor neuron protein OS=Rattus norvegicus OX=10116 GN=Smn1 PE=1 SV=1
19	Q16637	0.004	42.0	294	0.031	0.068	SMN_HUMAN Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1
20	A0A1W2PRV5	0.005	42.0	282	0.031	0.071	A0A1W2PRV5_HUMAN Survival motor neuron protein (Fragment) OS=Homo sapiens OX=9606 GN=SMN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08585 RMI1_N	1.9e-14	65.6	RecQ mediated genome instability protein
2	PF06003 SMN	4.5e-05	34.4	Survival motor neuron protein (SMN)
3	PF00567 TUDOR	2.1e-07	42.4	Tudor domain
4	PF00627 UBA	0.00064	30.8	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381773	0.999	DNA topoisomerase 3-beta-1
2	9606.ENSP00000359506	0.986	Synaptic functional regulator FMR1
3	9606.ENSP00000350170	0.945	Fragile X mental retardation syndrome-related protein 1
4	9606.ENSP00000442336	0.906	DNA topoisomerase 3-alpha
5	9606.ENSP00000250113	0.894	Fragile X mental retardation syndrome-related protein 2
6	9606.ENSP00000470142	0.851	Regulator of nonsense transcripts 1
7	9606.ENSP00000263073	0.811	Telomerase-binding protein EST1A
8	9606.ENSP00000363382	0.730	Sushi domain containing 1
9	9606.ENSP00000368793	0.727	Peptide chain release factor 1, mitochondrial
10	9606.ENSP00000368612	0.726	Von Willebrand factor A domain-containing protein 8
11	9606.ENSP00000368716	0.715	N-alpha-acetyltransferase 16, NatA auxiliary subunit
12	9606.ENSP00000288985	0.714	DNA excision repair protein ERCC-6-like 2
13	9606.ENSP00000307853	0.703	Crossover junction endonuclease MUS81
14	9606.ENSP00000346762	0.703	Staphylococcal nuclease domain-containing protein 1
15	9606.ENSP00000376335	0.695	Integral membrane protein GPR155
16	9606.ENSP00000255120	0.690	Nuclear autoantigenic sperm protein
17	9606.ENSP00000347444	0.687	Tudor domain-containing protein 7
18	9606.ENSP00000381577	0.681	Ubiquitin carboxyl-terminal hydrolase 34
19	9606.ENSP00000382840	0.679	ATP-dependent RNA helicase DDX3X
20	9606.ENSP00000251864	0.677	Tudor domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0003712	0.998	transcription coregulator activity
GO:0003682	0.998	chromatin binding
GO:0035064	0.995	methylated histone binding
GO:0003713	0.994	transcription coactivator activity
GO:0003677	0.341	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.942	organic substance metabolic process
GO:0050789	0.939	regulation of biological process
GO:0006807	0.936	nitrogen compound metabolic process
GO:0043170	0.917	macromolecule metabolic process
GO:0044238	0.913	primary metabolic process
GO:0044237	0.846	cellular metabolic process
GO:0050794	0.801	regulation of cellular process
GO:0034641	0.668	cellular nitrogen compound metabolic process
GO:0006725	0.647	cellular aromatic compound metabolic process
GO:0046483	0.646	heterocycle metabolic process
GO:0090304	0.642	nucleic acid metabolic process
GO:0019222	0.504	regulation of metabolic process
GO:0044260	0.473	cellular macromolecule metabolic process
GO:0071840	0.451	cellular component organization or biogenesis
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0048519	0.449	negative regulation of biological process
GO:0016043	0.400	cellular component organization
GO:0050896	0.392	response to stimulus
GO:0010468	0.358	regulation of gene expression
GO:0080090	0.347	regulation of primary metabolic process
GO:0051171	0.347	regulation of nitrogen compound metabolic process
GO:0031323	0.346	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005794	1.000	Golgi apparatus
GO:0005654	1.000	nucleoplasm
GO:0032991	0.982	protein-containing complex
GO:0043232	0.565	intracellular non-membrane-bounded organelle
GO:0140513	0.448	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]