StarFunc result for job id Q9H7E9

User Input

>input (229 residues)
MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPL
GDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQ
LELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRA
LRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H7E9	1.000	1.000	7.104E-32	229	1.000	1.000	Q9H7E9.pdb.gz	CH033_HUMAN UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1
2	AFDB:F4I3V6	0.142	0.166	1.969E-1	192	0.127	0.151	F4I3V6.pdb.gz	SHW1_ARATH Protein SHORT HYPOCOTYL IN WHITE LIGHT 1 OS=Arabidopsis thaliana OX=3702 GN=SHW1 PE=1 SV=1
3	AFDB:P12755	0.143	0.063	1.969E-1	728	0.179	0.056	P12755.pdb.gz	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
4	AFDB:B0S7D7	0.154	0.058	2.694E-1	727	0.166	0.052	B0S7D7.pdb.gz
5	AFDB:F8WJN3	0.163	0.093	3.252E-1	478	0.144	0.069	F8WJN3.pdb.gz	F8WJN3_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=1
6	AFDB:Q9FXA2	0.139	0.059	4.449E-1	671	0.131	0.045	Q9FXA2.pdb.gz	PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=PAB8 PE=1 SV=1
7	AFDB:F1Q9J0	0.118	0.060	4.737E-1	480	0.127	0.060	F1Q9J0.pdb.gz
8	AFDB:O43040	0.125	0.096	4.737E-1	363	0.127	0.080	O43040.pdb.gz	CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf1 PE=1 SV=1
9	AFDB:E1BSJ7	0.162	0.058	5.044E-1	750	0.197	0.060	E1BSJ7.pdb.gz	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
10	AFDB:E7FFT2	0.166	0.052	6.482E-1	916	0.109	0.027	E7FFT2.pdb.gz	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
11	PDB:5svaU	0.147	0.205	9.724E-1	156	0.074	0.109	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:7enag	0.161	0.209	1.330	166	0.074	0.102	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7zu0E	0.141	0.103	1.330	343	0.079	0.052	7zu0E.pdb.gz
14	PDB:5n9jG	0.136	0.179	1.606	163	0.057	0.080	5n9jG.pdb.gz
15	PDB:7eebK	0.109	0.162	1.710	143	0.061	0.098	7eebK.pdb.gz	Structure of a mammalian sperm cation channel complex.
16	PDB:6ta5D	0.177	0.122	2.339	345	0.066	0.043	6ta5D.pdb.gz
17	PDB:6cnnA	0.133	0.093	3.006	360	0.044	0.028	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
18	PDB:1tjlA	0.177	0.265	3.200	145	0.087	0.138	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
19	PDB:6f1eA	0.167	0.251	3.408	143	0.074	0.119	6f1eA.pdb.gz
20	PDB:4v6wCR	0.194	0.215	3.628	203	0.057	0.064	4v6wCR.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H7E9	3.10e-168	464	229	1.000	1.000	CH033_HUMAN UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1
2	P13705	4.1	31.2	1091	0.140	0.029	MSH3_MOUSE DNA mismatch repair protein Msh3 OS=Mus musculus OX=10090 GN=Msh3 PE=2 SV=3
3	Q38DP5	4.6	30.8	344	0.083	0.055	Q38DP5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2610 PE=4 SV=1
4	O01761	5.4	30.8	8081	0.148	0.004	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
5	P47116	6.2	30.4	818	0.066	0.018	PTK2_YEAST Serine/threonine-protein kinase PTK2/STK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15393 DUF4615	4.2e-34	129.5	Domain of unknown function (DUF4615)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385787	0.623	Ribonucleases P/MRP protein subunit POP1
2	9606.ENSP00000457241	0.566	Translin-associated factor X-interacting protein 1
3	9606.ENSP00000445979	0.558	Zinc finger protein 623
4	9606.ENSP00000421489	0.518	Tigger transposable element-derived protein 5
5	9606.ENSP00000239690	0.507	NudC domain containing 1
6	9606.ENSP00000276704	0.504	Uncharacterized protein C8orf76
7	9606.ENSP00000481928	0.504	Zinc fingers and homeoboxes protein 1, isoform 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.994	regulation of biological process
GO:0043170	0.991	macromolecule metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0044238	0.959	primary metabolic process
GO:0006807	0.948	nitrogen compound metabolic process
GO:0044260	0.891	cellular macromolecule metabolic process
GO:0019222	0.802	regulation of metabolic process
GO:0060255	0.732	regulation of macromolecule metabolic process
GO:0048519	0.730	negative regulation of biological process
GO:0048523	0.686	negative regulation of cellular process
GO:0010468	0.667	regulation of gene expression
GO:0051171	0.626	regulation of nitrogen compound metabolic process
GO:0034641	0.585	cellular nitrogen compound metabolic process
GO:0080090	0.524	regulation of primary metabolic process
GO:0031323	0.483	regulation of cellular metabolic process
GO:0046483	0.455	heterocycle metabolic process
GO:0048518	0.409	positive regulation of biological process
GO:1901360	0.402	organic cyclic compound metabolic process
GO:0006725	0.378	cellular aromatic compound metabolic process
GO:0006139	0.368	nucleobase-containing compound metabolic process
GO:0048522	0.356	positive regulation of cellular process
GO:0009889	0.328	regulation of biosynthetic process
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0090304	0.313	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.998	nuclear lumen
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005654	0.958	nucleoplasm
GO:0005730	0.848	nucleolus
GO:0005856	0.505	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]