StarFunc result for job id Q9H7F0

User Input

>input (1226 residues)
MDREERKTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCV
RAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTE
ENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLT
KGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVV
MSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLN
GTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDVKGIGDELYNPETHKRHTLF
CGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAV
AGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFC
ISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARFLSPEENVCNEMLVKSQFVA
CMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPE
STPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAG
LCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLI
IMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEALPPK
DGKVAKINWHYADSLTQCSHPSAIDPEAIPVKLVHDSLEDLQMTRYHFAMNGKSFSVILE
HFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISL
SELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSIL
SNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGF
QSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFIS
SFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPY
QWRVTMLIIVLVNAFVSITVEESVDRWGKCCLPWALGCRKKTPKAKYMYLAQELLVDPEW
PPKPQTTTEAKALVKENGSCQIITIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VNC0	0.885	0.891	0.000	1218	0.407	0.410	Q4VNC0.pdb.gz	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
2	AFDB:Q4VNC1	0.876	0.898	0.000	1196	0.438	0.449	Q4VNC1.pdb.gz	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
3	AFDB:Q5XF90	0.886	0.910	0.000	1193	0.431	0.443	Q5XF90.pdb.gz	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
4	AFDB:Q9H7F0	1.000	1.000	0.000	1226	1.000	1.000	Q9H7F0.pdb.gz	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
5	AFDB:Q9NQ11	0.847	0.879	2.209E-100	1180	0.399	0.414	Q9NQ11.pdb.gz	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
6	AFDB:A0A2R8QKM0	0.863	0.903	1.233E-99	1170	0.387	0.405	A0A2R8QKM0.pdb.gz
7	AFDB:H2L3J0	0.841	0.900	2.427E-97	1143	0.389	0.417	H2L3J0.pdb.gz	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
8	AFDB:F1MAA4	0.820	0.876	6.662E-96	1145	0.398	0.426	F1MAA4.pdb.gz	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
9	AFDB:A0A0G2JX15	0.784	0.861	1.113E-92	1114	0.384	0.423	A0A0G2JX15.pdb.gz	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2
10	AFDB:Q27533	0.822	0.803	3.916E-92	1256	0.389	0.380	Q27533.pdb.gz	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
11	PDB:7vpkA	0.715	0.820	1.416E-80	1055	0.388	0.451	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
12	PDB:7m5xA	0.681	0.820	3.032E-78	1000	0.378	0.464	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
13	PDB:6xmtA	0.642	0.710	4.752E-57	1092	0.229	0.257	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
14	PDB:7e7sA	0.500	0.585	8.776E-37	1020	0.170	0.205	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:5zmwA	0.493	0.589	2.131E-34	1000	0.161	0.197	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
16	PDB:7x20A	0.499	0.600	2.230E-33	986	0.163	0.203	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
17	PDB:8d3xA	0.504	0.607	1.905E-30	989	0.152	0.188	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
18	PDB:6rohA	0.537	0.584	4.997E-30	1112	0.135	0.148	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
19	PDB:7py4A	0.521	0.567	1.994E-29	1112	0.139	0.154	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
20	PDB:7rd6A	0.528	0.672	2.358E-29	929	0.134	0.177	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTP8	0.0	820	1133	0.393	0.425	A0A8I5ZTP8_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=1
2	A1A5E5	0.0	835	1170	0.394	0.413	A1A5E5_DANRE Cation-transporting ATPase OS=Danio rerio OX=7955 GN=zgc:136762 PE=1 SV=1
3	B5DEH6	0.0	862	1145	0.400	0.429	B5DEH6_RAT Cation-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=2 SV=1
4	D3YT44	0.0	573	893	0.276	0.378	D3YT44_CAEEL Cation-transporting ATPase 13A3 OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
5	F1MAA4	0.0	875	1173	0.403	0.421	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
6	F5GUA7	0.0	787	1207	0.378	0.384	F5GUA7_CAEEL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
7	H2L3J0	0.0	814	1143	0.393	0.422	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
8	O74431	0.0	712	1315	0.351	0.327	ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.11c PE=3 SV=1
9	Q12697	0.0	709	1472	0.365	0.304	YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPK9 PE=1 SV=1
10	Q21286	0.0	749	1203	0.374	0.382	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
11	Q27533	0.0	790	1256	0.390	0.381	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
12	Q4VNC0	0.0	911	1218	0.412	0.415	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
13	Q4VNC1	0.0	994	1196	0.444	0.455	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
14	Q54X63	0.0	594	1158	0.330	0.349	Q54X63_DICDI Cation-transporting ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279183 PE=3 SV=1
15	Q5XF90	0.0	1003	1193	0.437	0.449	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
16	Q8N4D4	0.0	853	1088	0.390	0.439	Q8N4D4_HUMAN ATP13A2 protein (Fragment) OS=Homo sapiens OX=9606 GN=ATP13A2 PE=2 SV=1
17	Q9CTG6	0.0	863	1169	0.398	0.417	AT132_MOUSE Polyamine-transporting ATPase 13A2 OS=Mus musculus OX=10090 GN=Atp13a2 PE=2 SV=3
18	Q9H7F0	0.0	2547	1226	1.000	1.000	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
19	Q9NQ11	0.0	865	1180	0.405	0.421	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
20	A0A0G2JX15	1.60e-135	442	1050	0.201	0.235	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	0.022	26.1	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	0.00011	33.6	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	0.034	25.2	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	2.5e-32	123.4	E1-E2 ATPase
5	PF20250 FapA_N	1.1e+02	13.6	Flagellar Assembly Protein A N-terminal region
6	PF00702 Hydrolase	7.5e-13	60.8	haloacid dehalogenase-like hydrolase
7	PF12409 P5-ATPase	3.4e-38	142.1	P5-type ATPase cation transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242839	0.819	Copper-transporting ATPase 2
2	9606.ENSP00000345728	0.726	Copper-transporting ATPase 1
3	9606.ENSP00000218008	0.676	Protein ATP1B4
4	9606.ENSP00000194130	0.645	Solute carrier family 13 member 1
5	9606.ENSP00000353557	0.645	Solute carrier family 35 member F1
6	9606.ENSP00000392511	0.625	Proline rich transmembrane protein 3
7	9606.ENSP00000253697	0.556	Uncharacterized protein C3orf20
8	9606.ENSP00000304188	0.542	Olfactory receptor 8U1
9	9606.ENSP00000240335	0.524	T-box transcription factor TBX4
10	9606.ENSP00000309640	0.524	Xyloside xylosyltransferase 1
11	9606.ENSP00000427661	0.515	Anion exchange protein 4
12	9606.ENSP00000304669	0.514	Catenin alpha-1
13	9606.ENSP00000376227	0.504	Transmembrane protein 44

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140358	0.996	P-type transmembrane transporter activity
GO:0005488	0.990	binding
GO:0008324	0.989	monoatomic cation transmembrane transporter activity
GO:0022853	0.987	active monoatomic ion transmembrane transporter activity
GO:0019829	0.984	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0022890	0.970	inorganic cation transmembrane transporter activity
GO:0046873	0.961	metal ion transmembrane transporter activity
GO:0005515	0.918	protein binding
GO:0015662	0.861	P-type ion transporter activity
GO:1901702	0.767	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0051179	0.895	localization
GO:0055085	0.783	transmembrane transport
GO:0065007	0.754	biological regulation
GO:0050794	0.406	regulation of cellular process
GO:0006811	0.362	monoatomic ion transport
GO:0050896	0.319	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031090	0.963	organelle membrane
GO:0031982	0.939	vesicle
GO:0071944	0.908	cell periphery
GO:0031410	0.906	cytoplasmic vesicle
GO:0098588	0.882	bounding membrane of organelle
GO:0005768	0.854	endosome
GO:0005886	0.793	plasma membrane
GO:0030659	0.706	cytoplasmic vesicle membrane
GO:0005770	0.617	late endosome
GO:0031901	0.594	early endosome membrane
GO:0055037	0.593	recycling endosome
GO:0031902	0.490	late endosome membrane
GO:0055038	0.341	recycling endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.

[back to server]